SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000014907 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000014907
Domain Number 1 Region: 1147-1369
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.96e-61
Family DBL homology domain (DH-domain) 0.0000000509
Further Details:      
 
Domain Number 2 Region: 1369-1509
Classification Level Classification E-value
Superfamily PH domain-like 1.84e-29
Family Pleckstrin-homology domain (PH domain) 0.00000183
Further Details:      
 
Domain Number 3 Region: 239-342
Classification Level Classification E-value
Superfamily EF-hand 2.25e-28
Family Eps15 homology domain (EH domain) 0.0023
Further Details:      
 
Domain Number 4 Region: 1521-1619
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.15e-24
Family PLC-like (P variant) 0.0073
Further Details:      
 
Domain Number 5 Region: 1057-1143
Classification Level Classification E-value
Superfamily SH3-domain 1.21e-24
Family SH3-domain 0.0000214
Further Details:      
 
Domain Number 6 Region: 14-104
Classification Level Classification E-value
Superfamily EF-hand 1.21e-24
Family Eps15 homology domain (EH domain) 0.0013
Further Details:      
 
Domain Number 7 Region: 939-1001
Classification Level Classification E-value
Superfamily SH3-domain 3.68e-19
Family SH3-domain 0.00018
Further Details:      
 
Domain Number 8 Region: 709-796
Classification Level Classification E-value
Superfamily SH3-domain 1.58e-16
Family SH3-domain 0.00028
Further Details:      
 
Domain Number 9 Region: 825-904
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000971
Family SH3-domain 0.00056
Further Details:      
 
Domain Number 10 Region: 1023-1077
Classification Level Classification E-value
Superfamily SH3-domain 0.000000122
Family SH3-domain 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000014907   Gene: ENSGACG00000011256   Transcript: ENSGACT00000014935
Sequence length 1648
Comment pep:known_by_projection group:BROADS1:groupXVIII:11449724:11468059:-1 gene:ENSGACG00000011256 transcript:ENSGACT00000014935 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RVRFHSFVRAGGASVWAVTPEEREKYDKQFDALAPVLGYVSGEQARKFFLRSGLPASVLA
EIWNIADMDSDGKMDRQEFSIAMKLVKLKLQGRNLPSVLPIPMKQLPVAISAPNVPLSAR
FGMGSMPNLSIGLSSMPCMSAMPILTPFPANPSMHAVQTFVPTPMTLPLINCLGNSGLPN
GNVNLRTPPLLPNSSALPLSGFSSPMAFSPSTGMSNANSLLDLGSSSSNSSSTTSLAGNS
PKTGASDWAVPQGSRLKYRQQFNTLDKLMSGYLSGPQVRNALIASNLTQTQLATIWNLAD
VDKDGQLRADEFILAMHLVDMAKTGRPLPLTLPQDLVPPSLRGGIKPGELVNGTGPYIPP
CLIDAPEIEPVLKTKSSVSFEDKLKENFARGSAELEKRRLARGNSPAREVPGTSGPPRPG
DDRVPPCFQAAKLEMERQQREEWERGMRQELGGRREGEQEEISRLRAKKKSLELELEDVG
NKHKQISGRLRDAQSKRRILKAEVDHVNQKRDSRNIEINTLQLQLEDWQKKLSLLVPEQH
RLTEKLRNLNLNKISPVTLTSLSGSATEKGGNCRRLKGQLDTLERETTDKLAQMEQYNKE
LKLGDMDDCVLRGLLSLLACLSQLFLLIKELREKQVRQQAVLDDLHRVKEEKQRELQRRR
LYLCRALKVYFPQTGEARAREKAQACLQAAQEKAEEQERGGQPALEAQRPSELTAYRALY
SFVARNADELSVDAGGLIEQVDEQAVGEPGWFCGSYRGNRGWFPQSYAEKCPTRSTAETA
APPSPGRLSRPPPPPLNSRLESSLFSSTSSPAVTYLQTCVRNRWQRKQRSHRSPSPNTIR
PSHPTPQTSVPLLARAVSSWSATSEKTLNLGSGDVIGVLQQRGDWWLGQLNGTQGWFPKS
YVALETGGNTEYEDTQECTRLSELLSAHTQLTVCCSHSTKPEYVALYTYESPEVGDLTFV
EGDVVMVTEREGEWWRGCIGDQTGVFPSNYVRPVEPEVQIVSKPGAPIKKPEIAQAVTTA
AVAPTTHQLHLSPGQLIVVLAKNSAGWWLGELQARGKKRQRGWFHSSHVKLLGPSSSKSS
PSPLPVCQVIAMYDYTAANRDELSFSKGQLISILDKTNPDWWKGDANGATGLLPTNYVTM
TTESDPSQQWCADLMTLDTMTPQERKRQGYIHELIRTEETYVEDLELVLEVFYKPMSESG
RLTEAETGAIFVNWRELIMCNTKLLKALRVRKKTEGENMPVQLIGDLLASELAHMQPYIR
FCSCQLNAAALLQSKTHHQPDFKDFLRKIATNYRCKGMPLSSFLLKPMQRITRYPLLIKN
ILEHTPDCHGDRGPLREALQRAEELCSQVNEGVREKENSDRLEWTQSHVQCEGAIEHLVF
NSLTNCLGPRKLLHSGRLYKTKSSRELWAFLFNDFLLLTHSAKPFSSSGPDKLFSLKTSI
QLKMYKAPLFLNEVLVKRPPDPSSDEPIFHVSHIDRVYALKTETLTERTTWVQKIKAASE
QFIETEKKKREKAYQARSLKSSGIGRLLVTVSEALELKACKPNGKSNPYCELTMGAQCYT
SRPISDTLNPKWNFHCQFFVKDLYQDILCVTVFEKDQFSPDDFLGRTEVPVATIKKEMES
KGAANRRLLLHEVPTGEVWVKLDLQLYE
Download sequence
Identical sequences G3PBD3
ENSGACP00000014907

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]