SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000014915 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000014915
Domain Number 1 Region: 525-668
Classification Level Classification E-value
Superfamily PH domain-like 1.63e-30
Family Pleckstrin-homology domain (PH domain) 0.0044
Further Details:      
 
Domain Number 2 Region: 677-791
Classification Level Classification E-value
Superfamily PH domain-like 9.86e-18
Family Pleckstrin-homology domain (PH domain) 0.017
Further Details:      
 
Domain Number 3 Region: 1092-1218
Classification Level Classification E-value
Superfamily Second domain of FERM 4.32e-17
Family Second domain of FERM 0.0066
Further Details:      
 
Domain Number 4 Region: 988-1065
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000258
Family First domain of FERM 0.073
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000014915
Domain Number - Region: 37-167
Classification Level Classification E-value
Superfamily Tropomyosin 0.0133
Family Tropomyosin 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000014915   Gene: ENSGACG00000011275   Transcript: ENSGACT00000014943
Sequence length 1353
Comment pep:known_by_projection group:BROADS1:groupXV:10793856:10814743:1 gene:ENSGACG00000011275 transcript:ENSGACT00000014943 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GSRDVSAAGVDWQKRCIALETQLLKFRLQAGKIRELLAEKMQELEQRVTEADQRAESAEK
QIHVMEEKLKSANIQTSETESSSYRRYQDLTNRVQEKDAVIKRLEVQLEKQIFVRAQEAK
IIEEKAAKIKDWVTFKLKEMEQENQLLKMANLKQTEQIMLLQDKLQEKPASSGSPAASPM
MDTHQVPSSPLFPPSCPGTPPAQDDGWRQAGPRGAALGPATLAGCSDNSSDELSSKFRSQ
CLHSSSSSSSSSSAYEMAQGPSSLEPSLRITPKSPLLSRSPSTNNPFPNAPVHQSGTSTT
LPKIRTPLTPRDSIQLVKKHCSQPQPSLDRLHHLNVNIDMVPPSSACSTLKSTGAASSPF
SQVVEETDIDDGLPDSMDGVVEGSGSEEPRRNGVSFVGLPEELEPPTPPLHRFPSWESRI
YAVAKSGMRVSEAGPAARGPGRGSNFPQYPAAGPFPQLIYRNINVPVYTTLKGKATQISS
VPLLDDDSGSEDDSSSLASLRTSVLLPDKKGSVPGSPRAVKRGVSMSSISSESDYAIPPD
AYSLDSDYSEPEHKVQRTSSYSCESSGPVSGEMLEKSGYLLKMGSQVKAWKRRWFILRNG
EILYYKSPSDVIRKPQGQIQLNSSCRIVRGEGAQTFQLITEKKTFYLTADSPNILEEWIR
VLQNILKVQASSPVTVETTAKPTVRGWLTKVKHGHSKLVWCSLVGKVFSYYRNQEDKLPL
GQLKMREASVKEVDRSCDSDEDYEAGSRGFLSSHCTLVVQPRDQSPTYMLIGTKQEKDTW
LYHLTVAAGSCATFRVGTECEQLIGKLLDAEGDPESALWRSEALSFCKEGLRSPLTTLPS
EALQTEAIKLFKSCQLFINVLVESPSVDYHTSLAQNALQVCLTHPELQNEVYCQLIKQTN
RRTPHNYSLTQCWQLLSLCVALFLPQQHFLWYLRQYLQRNADPRSEVGKYAVYCERSVQR
TLQNGEREAKPSRMEIVSILLRNPYHHSLPFSIPVHFMNNTYQVVGFDGSTTVEEFLNTL
NQRIGLRKPQLSGFALFTDDPSGKDLEHCLQPAAKICDVISKWEQALKELHPGKNEGTRI
VRLTYKSRLCFRSQVKGETDRERLLLAYQLNDEVQQGHFPVNKELALEVAALMAQVEHGD
LERPASSSPTGSPLPKSQLILLQALERFYPKRYKQDCSSEQLRDLAERLATKWSMLRGCS
APECVRIYLTVARKWPLFGAKLFSAKPLPPSPVEQSQVWLAVNEDGLCVLDYAMHTLVTH
SYSSVITFGGCRDDFMVVTSQQREPGLGKKSVEKLLFAMAKPKILELTLLMASYINHWNH
SLPPASPQPLGHWDVDSKHFPAMSYTTKGPTLL
Download sequence
Identical sequences G3PBE1
ENSGACP00000014915 69293.ENSGACP00000014915 ENSGACP00000014918

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]