SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000014918 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000014918
Domain Number 1 Region: 411-537
Classification Level Classification E-value
Superfamily Second domain of FERM 1.57e-17
Family Second domain of FERM 0.0066
Further Details:      
 
Domain Number 2 Region: 11-110
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000516
Family Pleckstrin-homology domain (PH domain) 0.019
Further Details:      
 
Domain Number 3 Region: 307-384
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000101
Family First domain of FERM 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000014918   Gene: ENSGACG00000011275   Transcript: ENSGACT00000014946
Sequence length 672
Comment pep:known_by_projection group:BROADS1:groupXV:10806729:10814746:1 gene:ENSGACG00000011275 transcript:ENSGACT00000014946 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSFAKACRLVKHGHSKLVWCSLVGKVFSYYRNQEDKLPLGQLKMREASVKEVDRSCDSDE
DYEAGSRGFLSSHCTLVVQPRDQSPTYMLIGTKQEKDTWLYHLTVAAGSCATFRVGTECE
QLIGKLLDAEGDPESALWRSEALSFCKEGLRSPLTTLPSEALQTEAIKLFKSCQLFINVL
VESPSVDYHTSLAQNALQVCLTHPELQNEVYCQLIKQTNRRTPHNYSLTQCWQLLSLCVA
LFLPQQHFLWYLRQYLQRNADPRSEVGKYAVYCERSVQRTLQNGEREAKPSRMEIVSILL
RNPYHHSLPFSIPVHFMNNTYQVVGFDGSTTVEEFLNTLNQRIGLRKPQLSGFALFTDDP
SGKDLEHCLQPAAKICDVISKWEQALKELHPGKNEGTRIVRLTYKSRLCFRSQVKGETDR
ERLLLAYQLNDEVQQGHFPVNKELALEVAALMAQVEHGDLERPASSSPTGSPLPKSQLIL
LQALERFYPKRYKQDCSSEQLRDLAERLATKWSMLRGCSAPECVRIYLTVARKWPLFGAK
LFSAKPLPPSPVEQSQVWLAVNEDGLCVLDYAMHTLVTHSYSSVITFGGCRDDFMVVTSQ
QREPGLGKKSVEKLLFAMAKPKILELTLLMASYINHWNHSLPPASPQPLGHWDVDSKHFP
AMSYTTKGPTLL
Download sequence
Identical sequences G3PBE4
ENSGACP00000014918

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]