SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000014938 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000014938
Domain Number 1 Region: 1218-1440
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 9.81e-63
Family DBL homology domain (DH-domain) 0.00000000726
Further Details:      
 
Domain Number 2 Region: 1440-1580
Classification Level Classification E-value
Superfamily PH domain-like 2.33e-31
Family Pleckstrin-homology domain (PH domain) 0.000000265
Further Details:      
 
Domain Number 3 Region: 191-289
Classification Level Classification E-value
Superfamily EF-hand 2.09e-28
Family Eps15 homology domain (EH domain) 0.0015
Further Details:      
 
Domain Number 4 Region: 1146-1218
Classification Level Classification E-value
Superfamily SH3-domain 3.28e-27
Family SH3-domain 0.0000827
Further Details:      
 
Domain Number 5 Region: 1594-1714
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 3.59e-26
Family PLC-like (P variant) 0.0088
Further Details:      
 
Domain Number 6 Region: 15-111
Classification Level Classification E-value
Superfamily EF-hand 2.64e-22
Family Eps15 homology domain (EH domain) 0.0021
Further Details:      
 
Domain Number 7 Region: 704-786
Classification Level Classification E-value
Superfamily SH3-domain 1.44e-20
Family SH3-domain 0.00014
Further Details:      
 
Domain Number 8 Region: 887-964
Classification Level Classification E-value
Superfamily SH3-domain 4.46e-20
Family SH3-domain 0.00013
Further Details:      
 
Domain Number 9 Region: 1002-1055
Classification Level Classification E-value
Superfamily SH3-domain 5.91e-20
Family SH3-domain 0.00018
Further Details:      
 
Domain Number 10 Region: 1072-1144
Classification Level Classification E-value
Superfamily SH3-domain 1.84e-17
Family SH3-domain 0.0000719
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000014938   Gene: ENSGACG00000011288   Transcript: ENSGACT00000014966
Sequence length 1721
Comment pep:known_by_projection group:BROADS1:groupVI:14537870:14562218:-1 gene:ENSGACG00000011288 transcript:ENSGACT00000014966 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQFPTTFTGCGPDAFLISVDERAKHDQQFLSLSPTPGGYITVRQGDQARNFFLQSGLPP
PVLAQIWALADMNSDGRMDIHEFSIAMKLIKLKLQGHPLPPALPPSMKQPQLTLPPQGGF
ALPVGVSPPLGSSALPPLPPPIANGAPPTGMMAPTSGFPHPAASVNKSSSFNRSSAKLQK
GTSVDVTSVQPPCDWAVPQSSRLKYRQLFNSHDKMMSGHLTGPQARTILMQSSLPQGQLA
TIWSLSDIDQDGKLTAEEFILAMHLIDMAMSGLPLPPVLPPDYLPPTFRRVRSDSVQSDQ
KSVQEEAAEEEAESSQDKRLPVTFEDKKRENFERGNLELEKRRQALQELQRKEQERLAAL
EREEQERKERERLPRNHVRLQDPLPPPLSRRSQSKELDLHSLRLVAYNETAAKRELERQR
QLEWERQRRQELLTQRNREQESIVLLKARKKTLEFELEALNDKKSQLEGKLKDVRFRLSA
QRREVEQTNLTRETRIAEITLLQQQLQDSQQWLGRLIPDKQSLNEELQQVQQNSLHRDSL
SSLQKAVEQKESSRQQLREQLDAVERETRAKLLEIDAFNTQLKELREIHSRQQRQKQREL
EGDTHTLTHTHPHMHTPIERKSAELQHSRLSSEEAVSWRDEAASSAPNAPSPASISAPHA
WLNRVEKDVVQIPTSGYIECCLFRFSPATDTDGSSLCLLMKTPVSSFDQQQQPVKVVYYR
ALYPFDARSHDEISIAPGDVIMVDESQTGEPGWLGGELRGRTGWFPANYAERIPDSEAPI
SLRATASAPPTAAQQPMTTPPPAPGHASSSSATSANSNWADFSTTWPSSTAGQSESEGWD
AWPTSSTSQNPSLSVPSAQLRQRSAFTPATMTTGSSPSPVLGQGEKVEGLQAQALYPWRA
KKDNHLNFNKNEIITVLEQQDMWWLGELQTGQRGWFPKSYVKLISATMTPPPGAAPRMKN
TSEPPVSESPPNGKRPSPSPTKPSESGEGNARRLVEVCLRAEYVAMYTYESSEQGDLSFQ
QGDVVVVTRKEGDWWTGMVGGKTGVFPSNYVKPRDFASEALGPAGKTGSLGKKPEIAQVI
APYSATGAEQLTLAPGQLILIRKKNPGGWWEGELQARGKKRQIGWFPANYVKLLSPSTSK
TTPTEPTPPKLPPPEAVCQVIGMYDYVAQNDDELAFQKGQVITVLNKDDCDWWKGELNGR
EGLFPSNYVKLTTDTDPSTQWCADLHLLDMLSPMERKRQGYIHELIVTEENYVNDLQLVT
EIFHKPLLDCELLTEKEVAMIFVNWKELIMCNIKLLKALRVRKKMSGDRMPVKMIGDILT
NQLPHMQPYIRFCSCQLNGATLIQQKTDDNPEIKDFLKRLAMDSRCKGMPLSSFLLKPMQ
RVTRYPLIIKNIIENTPESHPDNSHLKAALEKAEELCSQVNEGVREKENSDRLEWIQAHV
QCEGLSEQLVFNSVTNCLGPRKFLHSGKLFKAKSSKELYGFLFNDFLLLTQVTKPLGWSG
SDKVFSSKTHLQYRMYKTPIFLNEVLVKLPTDPSGDEPLFHISHIDRVYTLRAESINERT
AWVQKIKAASELFIETEKKKREKAYLVRSQRATGIGRLMVNIVEGIELKPCRSHGKSNPY
CEVTMGSQCHITKTLQDTLNPKWNSNCQFFIKDLEQDVLCVTVFERDQFSPDDFLGRTEI
RLAEIKKDQGSKGPITKRLLLHEVPTGEIVVRLDLQLFEEP
Download sequence
Identical sequences G3PBG4
ENSGACP00000014938 ENSGACP00000014938 69293.ENSGACP00000014938

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]