SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000014941 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000014941
Domain Number 1 Region: 519-654
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 3.27e-38
Family Synaptotagmin-like (S variant) 0.00000104
Further Details:      
 
Domain Number 2 Region: 352-485
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.57e-35
Family Synaptotagmin-like (S variant) 0.0038
Further Details:      
 
Domain Number 3 Region: 37-156
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.8e-29
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.00000427
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000014941   Gene: ENSGACG00000011299   Transcript: ENSGACT00000014969
Sequence length 662
Comment pep:known_by_projection group:BROADS1:groupXIII:12860333:12873949:-1 gene:ENSGACG00000011299 transcript:ENSGACT00000014969 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTDTVVSSSSDRWQSNDRTKHAGGNWTMQPGPGPAPDLTDEEKEIINNVIARAEKMEAME
QERIGRLINRLDDMKKTVCGDGQSRCLLCGEQFGSPGVSSVVCEDCKKNMCTKCGTQCGS
RPRAVWLCKICREQREVWKRSGAWFFKGFPKQFLPSPMPLTKTTEGGAKEAAKAKEPRAP
EPRKTVIQPTGTSATSACKSSPEPQGRGGYPPVAPKPSVARMATGGAGPEEAGQGSPVAI
KKMIPTQSSRPPSAASATVAQQGERAAIGHNLLLSSSQRVPLTTYTASQASVFFSVTGPA
AGDGGAYSSAAGAPEQRMPPPAREDRRQPAAHGAPPARQQPPPAEEEEEANDYDSDEATT
LGSLEFSLLYEQENNSLHCSILKAKGLKPMDSNGLADPYVKLHLLPGASKSNKLRTKTLR
NTRNPAWNETLTYHGLTDDDMQRKTLRLSVCDEDKFGHNEFIGETRVALKKLKLNQKKNF
NVCLERVIPTKRTATAGGARGIALYEDEPGKEGGEVEERGRILISLMYSTQQNRLLVGVV
RCVHLAAMDANGYSDPYVKICLKPDMGKKAKCKTQIKKRTLNPEFNEEFGYEIKHSELAK
KSLAISVWDYDIGKSNDYIGGCQLGITAKGERLKHWYECLKNKDKRIERWHTLYNENPVT
SD
Download sequence
Identical sequences G3PBG7
ENSGACP00000014941 ENSGACP00000014941 69293.ENSGACP00000014941

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]