SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000014994 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000014994
Domain Number 1 Region: 553-636
Classification Level Classification E-value
Superfamily Kix domain of CBP (creb binding protein) 2.22e-36
Family Kix domain of CBP (creb binding protein) 0.0000047
Further Details:      
 
Domain Number 2 Region: 1000-1124
Classification Level Classification E-value
Superfamily Bromodomain 1.11e-34
Family Bromodomain 0.000000641
Further Details:      
 
Domain Number 3 Region: 310-404
Classification Level Classification E-value
Superfamily TAZ domain 2.62e-28
Family TAZ domain 0.00000142
Further Details:      
 
Domain Number 4 Region: 1966-2022
Classification Level Classification E-value
Superfamily Nuclear receptor coactivator interlocking domain 5.49e-25
Family Nuclear receptor coactivator interlocking domain 0.00014
Further Details:      
 
Domain Number 5 Region: 1679-1763
Classification Level Classification E-value
Superfamily TAZ domain 6.02e-24
Family TAZ domain 0.00000184
Further Details:      
 
Domain Number 6 Region: 1616-1663
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000002
Family ZZ domain 0.00011
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000014994
Domain Number - Region: 1204-1245
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000767
Family PHD domain 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000014994   Gene: ENSGACG00000011341   Transcript: ENSGACT00000015022
Sequence length 2319
Comment pep:known_by_projection group:BROADS1:groupXI:10017722:10042700:1 gene:ENSGACG00000011341 transcript:ENSGACT00000015022 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADNLLEVGPPIAKRPKLNSPLSVSDGPVDLVSLFDLEDDLPDELIPNGDLGMSSNGGPG
GGGPGLNSNAPDAAAKHKQLSELLRPGSSSILGGVLNSLSPQQGGMVESQLGAVLGKSSH
RQGSPNHQSPQAQKGGTPTGQGNGGMSFNQAMLNSGQGHGVMGQTGQVMNGALGPAGRGR
PGMQYQGQGMQGPQVGAGPGAGGSVLAETLTQGGPQLGAHNTLTAQQAGNMNKMGMSGGP
FGQQYGQSGVQQMGAAGVNAQQLQNKATLSNNLPQFPTELKGAGSVPNLMQQQVAAVGMV
PGAGGVSTGPTADPEKRKLIQQQLVLLLHAHKCQRREQANGEVRACTLPHCRTMKNVLNH
MTHCQAGKSCQVAHCASSRQIISHWKNCTRHDCPVCLPLKNASDKRNQQPMLSSPGASLQ
SAISTVGPGQPSATAINSAATHIDPSSMQRAYAALGLPYGNQSPAQGHGPPQHNPQGPQH
QQLRSLNPLGTNQMNQLAGGMGVPSADQAGMHSDSSLSSTLNNLSSQLMPDGSVVGGMGN
LPAATPLSSSGVRKAWHEHVTQDLRTHLVHKLVQAIFPTPDPAALKDRRMENLVAYARKV
EGDMYESANSRDEYYHFLAEKIYKIQKELEEKRRSRLQKQPGMVGTAGPQQPGMAQSNAM
GPGQGVRSPNGPVPMPNMPSQILNRMQAAQGINQFNPMAMQNAQMSQAPIGARAPSPMNH
PQQMNMSSVPTMGMSPSRMPQTQGMMGSHANNMVAHQANQGQFLQQGQFPAAAGGAMNVG
LGPPITQAAVTQPQNSNIPLNALGAHGPQLPCGPAAQPPLGATPPPSASASLQQLQQHLA
SAQAQVLHGPPSAKGTPNPSQPNTPLQLQTEPPSQMQQPTSVQAQHPSTPLSQAAASIDN
RVPTPASVAELSSQQALPDTGSAEAKLEVKDEEDDDDDNKSGKKQPDVKMEDDETKPLLA
KKEEPDAKEPKQEPMETEIKKLEIKTEPKDEEESGANGTSSSSSPQNRKKIFKPEELRQA
LMPTLEALYRQDPESLPFRQPVDPMLLGIPDYFDIVKNPIDLSTIKRKLDTGQYQEPWQY
VDDVWLMFNNAWLYNRKTSRVYKYCTKLAEVFEAEIDPVMQGLGYCCGRKYEFSPQTLCC
YGKQLCTISRDGTYYSYQNRYHFCEKCFNEIQGNSVTLGDDPAQTQTMISKEQFEKKKND
MLDPEPFVECKDCGRKMHQICVLHYDVIWPTGFICDNCLKKSGKTRKENRFSARRLQSTR
LGTYIEDRVNKYLKRQNHPEAGEVFVRVVASSDKNVEIKPGMKSRFVDSGEMVETFPYRT
KALFAFEEIDGVDVCFFGMHVQEYGSECPFPNTRRVYISYLDSIHFFRPRVLRTAVYHEI
LIGYLEYVKKLGYVMGHIWACPPSEGDDYIFHCHPVDQKIPKPKRLQEWYRKMLDKAFAE
RILHDYKDIFKQATEDRITSANELPYFEGDFWPNVLEESIKEQNTASTETPEGAQADSKN
AKKKNNKKTNKNKSSVSRANKKKPGMPNVANDLSQKLYATMEKHKEVFFVIHLHAGPVVN
TLPPIMDPDPLLTCDLMDGRDAFLTLARDKHWEFSSLRRCKWSTMCMLVELHNQGQDRFV
YTCNECKHHVETRWHCTVCEDYDLCINCYNAKGHEHQMVKWGLGLDDDNGQGGEASKSPQ
ESRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPVCKQLIAL
CCYHAKHCQENKCPVPFCLNIKHKLRQQQLQHRLQQAQMMRRRMATMAGRGMPMPSPPTS
AGPDTPNSVQQPNTPQTPQPMPTPNPANMSQGFPNNGRSSQPPTPVPQGKPGPQSSPLHQ
QASPLPNAALKVAKQIQMVAKAMQQSQWGPGMQNPMQNSQGHQPQVPSQHGPLAPQQAQG
TPMPQQNQLMQRPMMPQQQVLQMPGVIPPQGPSQQGMPPQQQRGIPGNIAPSALQDLLRT
LKSPSSPLQQQQVLNILKSNPRLMAAFINQRTAKYQATQQQQAQQQSAQAMSQTGMQTMA
AMANQVQRPVMAPQQPQQPGSQGMATMVPQGQMMNAAQNGNSPLYRRQQALRGPMQQQQQ
GGMPQGHGQFPQQQQTGPANYSQLRMQQQMVMQGGGGPMGPIPPASQMGQPGMGMDGPQN
HIQQRILQQQQQQQMLKQQMGSPAQANSMSPQPHMLQSQGQGGAHLPGKTMANTLGNQVR
SPAPVQSPRPHSQQPPHSSPSPRIQPQPSPQHGAQHSSSPHPSLGGPMSGSMEQRHMGTP
EQSAMLPQLNTPNRGGLSNDMVMGGDATGDTLEKFVEGL
Download sequence
Identical sequences G3PBM0
69293.ENSGACP00000014994 ENSGACP00000014994 ENSGACP00000014994

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]