SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000015005 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000015005
Domain Number 1 Region: 1-83
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.52e-26
Family Ras-binding domain, RBD 0.0000552
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000015005
Domain Number - Region: 231-316
Classification Level Classification E-value
Superfamily tRNA-binding arm 0.0523
Family Seryl-tRNA synthetase (SerRS) 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000015005   Gene: ENSGACG00000011348   Transcript: ENSGACT00000015033
Sequence length 423
Comment pep:known_by_projection group:BROADS1:groupXIX:13808684:13826419:1 gene:ENSGACG00000011348 transcript:ENSGACT00000015033 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELKVWVDGVVRVVCGLSEDTSCQDVVIALAQAIGQTGRYILIQRLRDTERQLLATEKPL
ESLAKLGQHGGEVQFFLRRTGPSSSDGPSSKQDRPSPPSLPKHPEPELSKRSQPKKALTF
NLGPSTSPRTKAKLLKSPVSPHALSPLPSPSKEEVIRNVFQQQERLRAMEAQLEALERES
HTWERPYSSPCPSPVPHAHVQEEMNTLELAARRNQAELAHEQFWEEELEAEVERERVMRR
KLGELHATLDDCGRRLHDFSVRSAQLEQEIRRESQEEGRANGPEESLDAIKAELQSRENQ
RTELEEQLSETDKALGKAESLMQDKQDELEELNKELRQCNLQQFIQQTGVLPAHAHSRTE
LREQLEQLELAHLLPDGYRNGAHTETPPRPTAKQFLGHPRNLQNPLVSSLNPEVVTSRES
SWR
Download sequence
Identical sequences G3PBN1
ENSGACP00000015005

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]