SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000015014 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000015014
Domain Number 1 Region: 1-83
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.62e-26
Family Ras-binding domain, RBD 0.0000552
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000015014
Domain Number - Region: 248-333
Classification Level Classification E-value
Superfamily tRNA-binding arm 0.0371
Family Seryl-tRNA synthetase (SerRS) 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000015014   Gene: ENSGACG00000011348   Transcript: ENSGACT00000015042
Sequence length 444
Comment pep:known_by_projection group:BROADS1:groupXIX:13808709:13826463:1 gene:ENSGACG00000011348 transcript:ENSGACT00000015042 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELKVWVDGVVRVVCGLSEDTSCQDVVIALAQAIGQTGRYILIQRLRDTERQLLATEKPL
ESLAKLGQHGGEVQFFLRRTGPSSSDGPSSKQDRPSPPSLPKHPEPELSKRSQPKKALTF
NLGPSTSPRTKAKLLKRSARDSPEQRASPSPSPSPVSPHALSPLPSPSKEEVIRNVFQQQ
ERLRAMEAQLEALERESHTWERPYSSPCPSPVPHAHVQEEMNTLELAARRNQAELAHEQF
WEEELEAEVERERVMRRKLGELHATLDDCGRRLHDFSVRSAQLEQEIRRESQEEGRANGP
EESLDAIKAELQSRENQRTELEEQLSETDKALGKAESLMQDKQDELEELNKELRQCNLQQ
FIQQTGVLPAHAHSRTELREQLEQLELAHLLPDGYRNGGLGAAHTETPPRPTAKQFLGHP
RNLQNPLVSSLNPEVVTSRESSWR
Download sequence
Identical sequences G3PBP0
69293.ENSGACP00000015014 ENSGACP00000015014 ENSGACP00000015014

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]