SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000015027 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000015027
Domain Number 1 Region: 143-198
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 3.99e-16
Family PHD domain 0.0019
Further Details:      
 
Domain Number 2 Region: 65-117
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000895
Family RING finger domain, C3HC4 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000015027   Gene: ENSGACG00000011362   Transcript: ENSGACT00000015055
Sequence length 1603
Comment pep:known_by_projection group:BROADS1:groupXIX:13831971:13841823:1 gene:ENSGACG00000011362 transcript:ENSGACT00000015055 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DDSDSGEEESEEGESDSGEEEEEGHRDGEDDEEDDDDDGVEEGDAKAEDGASGGIPIDLA
EMSSDEDAEKCPICLNSFSSQPVATPESCEHYFCLDCILAWAKNANSCPVDRIAFNSIYL
RKCYGGKITVQKPVKEGLEEVIDVDLEQTRCEVCRGSDREDRLLLCDGCDAGYHMECLTP
PLDSVPVEEWFCPGCEASNRHSRASADDVSDAESLPSTARPATSRPQSAAAGPTRAIART
QQSERVRANVNRHRITQARSSQLAPTYLIQSNWLDDTINAVVSGLNTAVYIRDLTPRVPS
SSRRKTGKRRKVRRRKTSSATGKSGTGARRRRRKVRRTKSRKNLMLQKAATPRGRIASNL
RIVKDTKNSSLPTVYRPSEQTLSSMRADIGAASLSIYGDPFDLDPFVDRDGEGQQARVTT
ILEAKRRGISRSALRSHQPVARPVTAGVSRRGMNIHQSGGDVEVSPVPDLLGSILSGQSV
LLMDSSDVVINRDGTLKAIKPSTMPSALNPSCSSSGDAGAQLSPGMSPNQGDAAQSSSSN
GDLAGSSHRSMNRTTPQSSSRLPPQMPCSASHIHPPSHSDLPPRGHPRLQPPRPLGPTRP
PGHWRNVGVEEPGPSSSVHPALSSASKSKGGASSRSQHQKATTKPAWVDVSVLPRIPKIK
RESSGIAQEGTSHGSNGYRVPETGMTCFTGDKGRQQSVDRQKGRPDGPAPRQRPDGSGSS
ASHPHYSLPSSSSSAVSFRINSSGNSWQSRQLSSSSSSPAGGGAQTSRSAKADEAKKRQM
HRDKKMLLASRVLGSKEPDSETIYDPFDPTLSDSSSSGGEAESAALEVHAHHPALQVEEE
HRSIDIKTEKQTSLLATSKVKTEPGLVDTGEDERFGRSGKSFKSEKADDTTAAYQSLRAL
KTEREALDEESGQSVDCESSSSAPSAAPTEKKLKLETSDSKPSPASKDLGQEKNSFRAAK
EIRCSSSERDRDCRADHRAVGQEGRLRGKEKERGRSSRETTRRARSTSESSLWNSPDETR
RKRRRSRSRDRRRSRSGSSSSSKERSRKKKPEQKSKERSDDRERDCDRRRVSTDKRRGRS
RSRSQEKKNVRSCSRSRSRSRERRKDHTQLQPSSLSSRDKESQSRERKGHGSRSSSREKK
KEGSPSKSSQKTCISSSKDTKLLQGKKKDKDVSQSSLKDDKAAAVTKLRIAATEIRKKDK
DCLSATVEILKEIKIEKDIKKEKQQSLGMFEDCCSPAQQIKKEEPDARRPTAAKDEEGSR
EDPIKTEMFEIKTEICEAPFVKSEPGSPELCHFTSSPAPITADALREAPAAASHAESTAP
VGQPGASGLPLPVKQEVLQPKEPVSAAGGAKAKAQVKRVTWNIQEPEGPQPQKSASKLSL
YKLKLKQEGARRPSSAVQTSSQEGGSVYPEEADVFSTVCFVMVDTEVVSNNKIVPTKALD
YNMRLCILVRAPTRTFRIKCKICLHSYNLYLLKQEIPGAARHPSKTTAVGPLSSSSTSEG
EQGDAEEGDLPRKDQYLKKLHMQERAVEEVKLAIKPFYQRRDIDKDEYKEILRKAVQKVC
HSKSGEINPVKVGNLVKAYVDKYKHARKHRKGEDSGQAQEAED
Download sequence
Identical sequences G3PBQ3
69293.ENSGACP00000015027 ENSGACP00000015027 ENSGACP00000015027

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]