SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000015028 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000015028
Domain Number 1 Region: 471-600
Classification Level Classification E-value
Superfamily PH domain-like 1.6e-33
Family Phosphotyrosine-binding domain (PTB) 0.0000137
Further Details:      
 
Domain Number 2 Region: 309-445
Classification Level Classification E-value
Superfamily PH domain-like 2.24e-32
Family Phosphotyrosine-binding domain (PTB) 0.0086
Further Details:      
 
Domain Number 3 Region: 181-218
Classification Level Classification E-value
Superfamily WW domain 0.000000000653
Family WW domain 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000015028   Gene: ENSGACG00000011369   Transcript: ENSGACT00000015056
Sequence length 646
Comment pep:known_by_projection group:BROADS1:groupI:12542061:12547334:1 gene:ENSGACG00000011369 transcript:ENSGACT00000015056 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NAKWVKEGRNQLRKVAENQQDQDHNCNISQNGNKEDFPHQNTTQEEQQGNEEQTKSPKIA
MTPGLSEEESKNILYQPKLIDTLESTEEKEREEDVKEKDKTSEEEDDEDTSGHIRGEAVT
QEPVDVETQREGSLVGRNACLLFSNVNGTPNDEEPGWPAPSQDNAADSSPNGNKESFWDS
SAFETDTDLPSGWMRVRDTTGTYYWHIPTGTTQWEPPSPLGKVGDSMMSSTMSLETTPCE
ETEESWAHLSSTDEGVCEGELWNEEAEVASDQSLKEFEGATLRYASINLNYNCSQSEEEE
KLAPLCTDLETKCFAVRSLGWVEMSEEDMVPGKSSVAVNNCIRQLSYHKHNLHDTAGIWG
EGKDMLMVLENDNMNLIDPLGQTLLHAQPICSIRVWGVGRDNGRDFAYVARDNLTQVLKC
HVFRCDSPAKNIATSLHEMCSKIMMERKASRPGVSRLSSDPNNPVVIPIEEFPAPKNELF
HRFTVYYLGCEAVAKPVGMDIINDTLAAAVNGKVKTDWTPVSVNIAPATLTILSKQSEEV
LSECRVRFLSFMGVGKDVHTFAFIMAEGPQDYTCHMFWCEPNAASLSEAVQAACMLRYQK
CLDARPPGLASCLPTPPADSVARRVKKGVQSLLGSFKSYRSGPQSP
Download sequence
Identical sequences G3PBQ4
ENSGACP00000015028 ENSGACP00000015028 69293.ENSGACP00000015028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]