SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000015043 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGACP00000015043
Domain Number - Region: 1116-1155
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0576
Family PHD domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000015043   Gene: ENSGACG00000011377   Transcript: ENSGACT00000015071
Sequence length 1159
Comment pep:known_by_projection group:BROADS1:groupXV:11028130:11036683:1 gene:ENSGACG00000011377 transcript:ENSGACT00000015071 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLEKYPNTPMSHKEILQVIQRERLKEISGTSPLACLNAMLHTNSRGEEGIFYKVPGRMGV
YTLKKDISDVANELSEEGSEESSDNLSDSQSTENDSSALAREGRRGRWMRRGTPSSPQPR
CTSPSVPAGKLISPSQKHGKKALKQALKQQQQRNQRRQGGMPTSQSPRLLLKTIKDMSDT
SATKTGRWQLLYCQMQYKKESIVLDLSTFPLQTDLCRPVVPRKVSQRSGRLGAGQLRRTK
CKIDVETPDSILVNTNLRAIINKHTFSVLPPDCQQRLLKLLPEVDRQACMDGLQKVTSSA
LNNEFFTSAAQSWKERLAEGEFTPELQLRIRQEIEKEKRVELWKDGFFENYYGENSGLSF
EESKELTKADVNPESAGPRSPPHRTGPAAQAPVDPKVNEDSDAAATAAKDAKPPKEPGKT
QSAQREPVPTTEPMRTRRAQYAEGRKLSGTAQPGPTPAAKRPQAEEPTEKASAGALPEKE
FKEEVKQEETKLPQLPVKTSRSLSASLEVIEDQPQVSVVKPAEDSEPLKRKSLGGIGDEL
TPEKRPRLTSVSSLSSVSSVSPPATSLSSPATPTSATNHRIPPLKIPVARILPVPLSPSQ
VSPRTPLPAPLSSPGRTGARTLADIKAKAQLARAQRVASKGAVPGPGPGGGSGEQKLPSP
SSTPPQASTRLPASSSSSRTGTPPSRPLESFGQPSPKSSDTSRPSKTDEDVQSQSAGSVG
AAPDGVHAHALKAQETIAGSTKAGCCARANNTLVTQLLQGKEVPLEKILPKSISTLEVKM
SNVPCGSKGRTAHSAEHRADKPLSHHFNAAGGVVSEYTRHQRELPDKQTQEQILQTLMQR
KGQQSQFHAGVGPQHDVHQLVHAKERQDKSRITGGLLGRKRIPRPAMTGHYLLNVSTYGR
GQEGKKLQQSVISNVSLSSLKRESTEEEEAAKGEEPASKCFFPAAVVKSEQLGFSIAKLD
EASGVQHCPGVKTEPGSEDGAACGEHSCPGAASSFSQSLRRHLQLRTSTQGNSQPCLTPA
DPHHQRQAAFHAQRTLDDQEAAAAPCYGGTISMSVPHTLSHSAAGVCSPAASSEADGGGS
VMSFSVTVTTIPAGHSAERGDPGEASPQRAFIEGADMEEVQSKCYCRLKAMIVCKGCGAF
CHDDCIGPSKLCVSCLVVR
Download sequence
Identical sequences G3PBR9
69293.ENSGACP00000015043 ENSGACP00000015046 ENSGACP00000015043

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]