SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000015064 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000015064
Domain Number 1 Region: 472-757
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 2.69e-42
Family C5 cytosine-specific DNA methylase, DCM 0.004
Further Details:      
 
Domain Number 2 Region: 131-272
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 7.22e-37
Family PWWP domain 0.0000164
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000015064
Domain Number - Region: 376-445
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000604
Family PHD domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000015064   Gene: ENSGACG00000011391   Transcript: ENSGACT00000015092
Sequence length 759
Comment pep:known_by_projection group:BROADS1:groupXV:11074948:11097040:1 gene:ENSGACG00000011391 transcript:ENSGACT00000015092 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EHKEEDRREAVKTEHKQAGRGRRGVGWEISLRQRPMPRITFQAGDPYYISKRTREEWLAK
WKMEAEKKSELMSAMNAMKDPEENETETQQQPQPPQQPTDPASPTVATTPEPVAIDDGDK
TSPKPADTEPEYEDSRGFGIGELVWGKLRGFSWWPGRIVSWWMTGRSRAADGTRWVMWFG
DGKFSVVCVEKLMPLSSFSNAFHQPTYNKQPMYKKAIYEVLQAASSRAGKSFTACPDSDE
TDTSKSVEMLNKQMIDWAMTGFQPTGPKGLEPPEEDRNPYKEVYPEMWVEPEAAAYTPPP
AKKPRKSTAEKPKVKDVIDERTRERLVHEVRQKCRSLEDICISCGSLNVSLEHPLFAGGM
CQSCKNCFLECAYQYDDDGYQSYCTICCGGREVLMCGNHNCCRCFCVECVDLLVGQGAAH
AAIKEDPWNCFMCGQKDAFGLLGRRSDWPNRLQHFFANNHDQDFETPNIYPPVMVEKRKP
IRVLSLFDGIATGLLVLKELGIEVDRYIASEVCEDSITVGIVRHQGRIMYVGDVRNVTRK
HIQEWGPFDLVIGGSPCNDLSIVNPARKGLFEGTGRLFFEFYRLLHEARPKEGDNRPFFW
LFENVVAMGVSDKRDISRFLECNPVMIDAKEVSAAHRARYFWGNLPGMNRPLSAMFNDRV
DLQDCLEHGRTAKFGKVRTITTRSNSIKQGKDQHFPVYMNEKEDILWCTEMERIFGFPVH
YTDVSNMSRLARQRLLGRSWSVPVIRHLFAPLKDYFACN
Download sequence
Identical sequences G3PBU0
ENSGACP00000015064 ENSGACP00000015064 69293.ENSGACP00000015064

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]