SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000015083 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000015083
Domain Number 1 Region: 416-728
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.69e-91
Family Protein kinases, catalytic subunit 0.0000000127
Further Details:      
 
Domain Number 2 Region: 3-128
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 4.21e-26
Family PLC-like (P variant) 0.00000594
Further Details:      
 
Domain Number 3 Region: 156-221
Classification Level Classification E-value
Superfamily Cysteine-rich domain 5.23e-19
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0029
Further Details:      
 
Domain Number 4 Region: 237-298
Classification Level Classification E-value
Superfamily Cysteine-rich domain 5.53e-18
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.00063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000015083   Gene: ENSGACG00000011409   Transcript: ENSGACT00000015111
Sequence length 748
Comment pep:known_by_projection group:BROADS1:groupVI:15173492:15205049:1 gene:ENSGACG00000011409 transcript:ENSGACT00000015111 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVIFNGTLRIRIREALDLKPTAWSLRHAVGPKTQSFLLDTYIALNVDDSRVGQTSTKQKT
NSPAWNDEFTAEVRGGRGIELSVFHDAPIGCDDFVANCVIRFEDILHRGSKHFEDWVSVS
SEGELYVMTHSYFCSFTGSTDNEERVFRQRMGPRKRQGAVRRRVHQVNGHKFMATFLRQP
TYCSHCRDFIWGVLGKQGYQCQVCTCVVHKRCHELIITKCAGMKKQEDTVEEQVGSQRFS
VNVPHKFSIHNFKVLTFCDHCGSLLWGLLRQGLQCKVCKVNVHRRCESNECPFCGVDAQE
ESPKSSPDLGVTPDKISNSGHRRKKLPQGQEPQQTLAGTPETQGDRCRSAPTSPCDQDAK
ELENIRKALSFGEEQKTPHALSSPSSDGAVAGDGEGGRANGEVGGHTAPQTRRVNLPDFV
FIKVLGKGSFGKVMLAELKGSDEVYAVKVLKKDVILQDDDVDCTLTEKRILALARQHPYL
TQLFCCFQTKDRLFFVMEYVNGGDLMFQIQRSRKFDEARSRFYAAEVTSALMFLHRHGVI
YRDLKLDNILLDEEGHCKLADFGMCKEGILDGVSTTTFCGTPDYIAPEILQELDYGPSVD
WWALGVLMYEMMAGQPPFEADNEDDLFESILHDDVLYPVWLSKEAVSILKAFMTKSPSKR
LGCVLAQGLEEAIKLHVFFREIDWTLLEQRKLRPPFKPRIKTKRDVNNFDQDFTREEPNL
TPVEDSIIKQINQDDFKGFSYFGDEAVA
Download sequence
Identical sequences G3PBV9
ENSGACP00000015083 ENSGACP00000015083 69293.ENSGACP00000015083

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]