SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000015154 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000015154
Domain Number 1 Region: 417-488
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.15e-37
Family PHD domain 0.0000498
Further Details:      
 
Domain Number 2 Region: 66-329
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 1.12e-20
Family Galactose oxidase, central domain 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000015154   Gene: ENSGACG00000011461   Transcript: ENSGACT00000015182
Sequence length 533
Comment pep:known_by_projection group:BROADS1:groupXIX:14489909:14491510:1 gene:ENSGACG00000011461 transcript:ENSGACT00000015182 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLQPLTPVNCAGLLQPGFSLLQLDGEVLLFGQKGWPKRSCPTGMFSVRFKCGEMKLRAI
SFSNDSCYLPPLRCPAVCRLDPYDGLPESYLIHGGRTPNNEISSSLYVLTTDSRGCNRKL
TLCCKEKELVGEVPGARYGHTMSVVHSHGKTACVLFGGRSYMPAGERTTESWNSVVDRPP
QVFLFDLEFGCCSAHALPALTDGQSFHLALAREDCVYLIGGHSVASDSRPPRLFRLRVEL
LQGSPLLSCETLTTGMSISSAIINRTGRAHNYIILGGYQSDSQKRMECSAVSVNESGIHF
EPLESPRWTPDITHSRTWFGSSVGEGSILLAVPTEGRPSQADMHYFYKVSFPTEEEAREE
EGTQGCSQDSTEYDDSTPLEDSEELYFGREPHELEDSDDGRVDNYNEEDEEDESQAGYWI
KCCLGCQVDPNIWEPYYSTELHRPAMIFCSRGEGGHWVHAQCMDLSETLLLRLSQGSKRY
FCLDHGGLPHQEMTPPRQVQPLKLTPMKVKDRKTPPTIKMSPAKKLFLRRLFE
Download sequence
Identical sequences G3PC30
ENSGACP00000015154 69293.ENSGACP00000015154 ENSGACP00000015154

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]