SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000015199 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000015199
Domain Number 1 Region: 3-181
Classification Level Classification E-value
Superfamily BRCA2 helical domain 1.03e-70
Family BRCA2 helical domain 0.000000844
Further Details:      
 
Domain Number 2 Region: 343-477
Classification Level Classification E-value
Superfamily BRCA2 tower domain 1.7e-42
Family BRCA2 tower domain 0.000076
Further Details:      
 
Domain Number 3 Region: 182-312
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.54e-40
Family Single strand DNA-binding domain, SSB 0.00000781
Further Details:      
 
Domain Number 4 Region: 564-698
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.86e-36
Family Single strand DNA-binding domain, SSB 0.00023
Further Details:      
 
Domain Number 5 Region: 315-343,479-561
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4.63e-30
Family Single strand DNA-binding domain, SSB 0.00064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000015199   Gene: ENSGACG00000011490   Transcript: ENSGACT00000015228
Sequence length 851
Comment pep:known_by_projection group:BROADS1:groupI:13362884:13366744:1 gene:ENSGACG00000011490 transcript:ENSGACT00000015228 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPNVELAQDMQDMRIRKKKRQTIRPLPGSLFLTKTSGVTRIPLKAALVFLLQLYRHGVHQ
HVCEISSETAESFRFNLKQFIKREALLDGGGVQLADGGWLIPSKDGTAGKEEFYRALCDT
PGVDPKLISDGWVDNHYRWVVWKQASMERSFPETMGGLCLTPEQVLLQLKYRYDVEVDHS
RRPALRRITERDDTAAKTLVLCVCGVVSRSFDDSKTPRGADAGGGNPSAVVWLTDGWYAI
RAQLDEPLTAMLRNGRVAVGSKLIVHGAQLVGSQEACSPLEAPEALMLKICANSSRPVRW
DAKLGFHKDPRPFLLPLSCLYSSGGQVGCVDMIVLRSYPIQWMERKPEGGVVFRSVRAEE
KEAKRFNGLKQKAMEILFAKIQDEFEKEDKGRTCDFTTQAISRQAIAGLQAGEELCEAVG
EDPAHLEALLSEQQVETLNTYRRCVMEKKQAQLHDRFQRALESAEASEGSCPKREVTPVW
RLGVADSRDQRGRVYQLNLWRPSSDLQALLKEGRRYKVYNLTTSDGKKHNGSSNVQLTGT
KKTQFQDLQASREWLSTRFQPRVSACFVDLQNPEFQSLCGEVDLTGFVIQIVDGQGFSPA
FYLADGELNFVKVRCFSSFAQSGLEDLVKPRVLLSLSNLQLRGQSASPTPVVYAGDLTVF
SANPKDAHLQESLSQNKNLRQSQENFFLIAEETLSRLVQSDGRRPLSSPALHTRTPALAT
SMIQDTTASVKCVLLMQGASQQLVRSRGTFTPVSRKPPAANCSTEKDAGSVKRRRALNYL
SHIPSPPPLLNLGSVASPCVNKTFNPPRRSGTPSTLKTVQTPAHKAQKVDSLVEDEWVND
EELAMIDTQAL
Download sequence
Identical sequences G3PC75
69293.ENSGACP00000015199 ENSGACP00000015199 ENSGACP00000015199

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]