SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000015251 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000015251
Domain Number 1 Region: 59-252
Classification Level Classification E-value
Superfamily Sec7 domain 5.1e-77
Family Sec7 domain 0.0000000139
Further Details:      
 
Domain Number 2 Region: 261-376
Classification Level Classification E-value
Superfamily PH domain-like 6.43e-34
Family Pleckstrin-homology domain (PH domain) 0.00000101
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000015251   Gene: ENSGACG00000011515   Transcript: ENSGACT00000015280
Sequence length 401
Comment pep:known_by_projection group:BROADS1:groupXX:12496386:12501175:-1 gene:ENSGACG00000011515 transcript:ENSGACT00000015280 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YETGSFVPIDLSPEERSELEDIRRRKGILLQEIQRLREELREAILEVEGLETSTEGSKTL
QKSRHVAMGRKKFNMDPKKGIVFLVENELLRHTSEDISQFLYKGEGLNKTAIGDYLGERD
DFNIKVLQAFVDLHEFTDLNLVQALRQFLWSFRLPGEAQKIDRMMEAFAQRYCHCNPGVF
QSTDTCYVLSFAIIMLNTSLHNPNVRDKPGVDRFISMNRGINEGGDLPEDLLRNLYESIK
NEPFKIPEDDGNDLTHTFFNPDREGWLLKLGGGRVKTWKRRWFILTDNCLYYFEYTTDKE
PRGIIPLENLSIREVEDPRKPNCFELYIPNNRGQLIKACKTEADGRVVEGNHNVYRISAP
TPEEKDEWIHSIKSAVSVDPFYEMLAARKKRISLKKKEEQP
Download sequence
Identical sequences G3PCC7
69293.ENSGACP00000015251 ENSGACP00000015251 ENSGACP00000015251

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]