SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000015271 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000015271
Domain Number 1 Region: 99-281
Classification Level Classification E-value
Superfamily PH domain-like 8.46e-55
Family Phosphotyrosine-binding domain (PTB) 0.000000279
Further Details:      
 
Domain Number 2 Region: 471-583
Classification Level Classification E-value
Superfamily SH2 domain 6.33e-27
Family SH2 domain 0.0000161
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000015271   Gene: ENSGACG00000011551   Transcript: ENSGACT00000015300
Sequence length 591
Comment pep:known_by_projection group:BROADS1:groupVIII:14785692:14795435:-1 gene:ENSGACG00000011551 transcript:ENSGACT00000015300 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPQWKFSNSLLSRSPSNSSSSSGSSKDSGKAAAPQTSSSHSSSSHRHLAAVLTSCDPGCV
TPCSLQAMRGQRVVAASSGSRSGMNRRTRVEGMWLGGEDFTQKGGFIHKPSQGWLHPDKK
IAGPGASYVVRYMGCIEVLKSMRSLDFNTRTQVTREAINRLCDIVPGGKGAWRKKAQNKA
LQSVMGKSNLRFAGMSIAVNISIDGLSLLIPTTRQVIAHHPMQSISFASGGDTDTPDYVA
YVAKDPVNQRACHILECSDGLAQGVISTIGQAFELQFKQYLHSPPKTMASAERCARTEEA
MWAEDEDFSQHDYYNSIPGKEPPVGGLVDSRLRPSGALLGHIHTQPQSKTAAQQTGSPGR
REQASYPPGQLCYELHWDTETTGSSGLTSDGYLCADGQPPGSRDYEEHQYVNTQSLENLD
VLAQGPNGHRGSRAPESPKKDLFDMRPFEDALKLHEACGGPAAGAGVRVLEDQWPSPPRR
RAPVAPNEDQLRRETWYHSRMSRRDAEKLLVRDGDFLVRESTTNPGQYVLTGMHCGLPKH
LLLVDPEGVVRTKDMLFESISHLIAYHLKNELPIVAAESELHLKQVVRRKQ
Download sequence
Identical sequences G3PCE7
ENSGACP00000015271 ENSGACP00000015271 69293.ENSGACP00000015271

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]