SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000015284 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000015284
Domain Number 1 Region: 1-93
Classification Level Classification E-value
Superfamily Ubiquitin-like 9.73e-36
Family Ubiquitin-related 0.0000197
Further Details:      
 
Domain Number 2 Region: 100-154
Classification Level Classification E-value
Superfamily Zn-binding ribosomal proteins 8.97e-21
Family Ribosomal protein S27a 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000015284   Gene: ENSGACG00000011558   Transcript: ENSGACT00000015313
Sequence length 156
Comment pep:known_by_projection group:BROADS1:groupVI:15393128:15395140:-1 gene:ENSGACG00000011558 transcript:ENSGACT00000015313 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
IQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKIHRLRRE
CPADECGAGVFMASHFDRHYCGKCCLTYCFNKPEDK
Download sequence
Identical sequences A0A060YFT4 A0A087Y571 A0A1A7XYW5 A0A1A8B1J4 A0A1A8C5I8 A0A1A8GP65 A0A1A8KMP5 A0A1A8L153 A0A1A8RGM1 A0A2I4AI00 A2Q0U4 B1A310 B9ELE8 C1BLE2 C3KI05 E0YP55 G3PCG0 P68200 Q7SXA3 W5LLP2
ENSAMXP00000020754 ENSGACP00000015284 NP_001187222.1.5077 NP_956796.1.45394 XP_003455526.1.78416 XP_003963790.1.43653 XP_004575832.1.88231 XP_005743613.1.53837 XP_005812668.1.87360 XP_005945885.1.24487 XP_006638483.1.81211 XP_006806933.1.46954 XP_006806934.1.46954 XP_007230176.1.101067 XP_007577064.1.10163 XP_008286554.1.38333 XP_008319624.1.100486 XP_008428691.1.1237 XP_010748172.1.61708 XP_010790874.1.77114 XP_010868135.1.71217 XP_011601287.1.43653 XP_012672489.1.3086 XP_012713318.1.37407 XP_013855143.1.33752 XP_014010339.1.97760 XP_014827191.1.96476 XP_014876205.1.100837 XP_015217943.1.81211 XP_015233007.1.42780 XP_015797491.1.37898 XP_016108958.1.42290 XP_016120656.1.42290 XP_016321463.1.79318 XP_016328917.1.79318 XP_016423454.1.44103 XP_016425654.1.44103 XP_017289177.1.84151 XP_017540759.1.86671 XP_018550129.1.34915 XP_018976200.1.5815 XP_019715769.1.30352 XP_019962168.1.63745 XP_020337564.1.87700 XP_020441850.1.23826 XP_020482568.1.8198 XP_020772661.1.12261 XP_021468602.1.32639 XP_022070175.1.10920 ENSDARP00000107110 ENSDARP00000128775

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]