SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000015290 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000015290
Domain Number 1 Region: 3-95
Classification Level Classification E-value
Superfamily Ubiquitin-like 9.95e-36
Family Ubiquitin-related 0.0000197
Further Details:      
 
Domain Number 2 Region: 102-156
Classification Level Classification E-value
Superfamily Zn-binding ribosomal proteins 9.15e-21
Family Ribosomal protein S27a 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000015290   Gene: ENSGACG00000011558   Transcript: ENSGACT00000015319
Sequence length 158
Comment pep:known_by_projection group:BROADS1:groupVI:15393130:15395144:-1 gene:ENSGACG00000011558 transcript:ENSGACT00000015319 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ARMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSD
YNIQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKIHRLR
RECPADECGAGVFMASHFDRHYCGKCCLTYCFNKPEDK
Download sequence
Identical sequences G3PCG6
ENSGACP00000015290 ENSGACP00000015290 69293.ENSGACP00000015290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]