SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000015302 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000015302
Domain Number 1 Region: 2085-2385
Classification Level Classification E-value
Superfamily BEACH domain 5.1e-123
Family BEACH domain 0.0000000000562
Further Details:      
 
Domain Number 2 Region: 113-299
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.67e-33
Family Clostridium neurotoxins, the second last domain 0.03
Further Details:      
 
Domain Number 3 Region: 2497-2750
Classification Level Classification E-value
Superfamily WD40 repeat-like 5.04e-31
Family WD40-repeat 0.0053
Further Details:      
 
Domain Number 4 Region: 1972-2080
Classification Level Classification E-value
Superfamily PH domain-like 3.14e-27
Family PreBEACH PH-like domain 0.00000335
Further Details:      
 
Domain Number 5 Region: 393-498,577-873
Classification Level Classification E-value
Superfamily ARM repeat 7.53e-16
Family Plakophilin 1 helical region 0.073
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000015302
Domain Number - Region: 13-126,389-418
Classification Level Classification E-value
Superfamily ARM repeat 0.00806
Family Armadillo repeat 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000015302   Gene: ENSGACG00000011555   Transcript: ENSGACT00000015331
Sequence length 2763
Comment pep:known_by_projection group:BROADS1:groupI:13479008:13605192:1 gene:ENSGACG00000011555 transcript:ENSGACT00000015331 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LVGGEFDLETNFIIQDAEGIGCMVELLGHCDVTCQAEVWSMFTAILRKSVRNLQTSTEVG
LIQQVLLIMSSVDDMIADLLVDMLGVLASYSITVKELKLLFSMLRGEGGLWPKHAVKMLS
VLNQMPQRHGPDAFFNFPGRSAAAIALPPIAKWPYQNGFTFNTWFRMDPLNNINVDKDKP
YLYCFRTSKGIGYSAHFVGNCLIVTSLKSKGKGFQHCVKYDFQPRKWYMISIVHIYSRWR
NSEIRCYVNGQLVSYGDMAWHVNTNDSYDKCFLGSSETADANRVFCGQLGAVYVFSEALN
PAQIFAIHQLGLGYKSTFKFKSESDIHLAEHHKQVLYDGKLASSIAFTYNAKATDAQLCL
ESSPQKHASIFVHSPHALMLQDVKATVTHSIHSAIHSIGGIQVLFPLFAQLDYHQLNDSQ
VEPSVCATLLAFLVELLKSSLAMQEQMLGGKGFLVIGYLLEKSSREHVSRAVLEQFLSFA
KYLDGLTHGAPLLKQLCDHILFNAAIWIHTPLKVQLSLYTYLSAEFIGTATIYNTIRRVG
TVLQLMHTLKYYHWAINPADSSGIEPSGLDGPRPTQKEIITLRAFILLFLKQLILKDRGV
KEDELQSILNYLLTMHEDENLHDVLQLVVALMSEHPASMIPAFDQRNGIRVIYKLMASKS
ESIRVQSLKVLGYFLKHLGHKRKVEIMHTHSLFTLLGERLMVHTNTVTVTTYNTLYEILT
EQVCTQVVHKPHPEPDSTVKIQNPMILKVIASLLKNSAPSNELMEVRRLFLSDMIKLFGN
SRENRRCLLQCSVWQDWMFSLGYINPKNSEEQKITEMVYNIFRILLYHAIKYEWGGWRVW
VDTLSIAHSKVTYEAHKEYLAKMYEEYQRQEEENIKKGKQGLVSTISGLSAQTSGLIGQS
EIRETDENSQTPESKKDFESADSRNLLAEGKGPEEALRGTVEAVRVEVQDLLVDIKAEKV
EATEVKLDDLDLSSENLGVSKNGALVEVDSLLNNVYCAAVEKLNSNVNSVLLSKCSMDEE
NAPPLITLDDYKDSIPNSNHFLCGKAAGSMEDKSLSDLGTAEPLLLHRPEPPVHTSASDE
LGLLARMTGGSELGSLHSILEQDEYELQAALAGISSVAVAKSESSSTRPEVTEGTASAAY
KGHPTSFEISSTADATTGASDTERLEDGKDKEACFIFPHPQSVHGHLTTQMERDMQLDLG
FGGTPMTEEQRRQFSPGPRTTMFRIPEFKWSAMHQRLLADLLFALESDVLVWRSHSTKSV
MDFVNSNENIIFVHNTIHLISQMVDNIIIACGGILPLLSAATSPTTEVENIEATQGMSSE
TAITFLSRLMVMVDVLVFSSSLNFSEIEAEKNMSSGGLMRQCLRLVCCVAVRNCLECRQR
HKERGNESSVPNNNETQEFPQNTVTSNNNLFSIKDPDRLLQDVDINRLRAVVFRDVDDSK
QAQFLALAVVYFISVLMVSKYRDILEPQRETARISHSGRSMRREVNSPTSIETPLEFART
KHNPVPLDRHIPHTDSGIGEEQLTSVLNGSDVDHTAGLLISTLSSEVKKSLDGLPESPGV
EVLKPPPPPPSSSITSISQPNKGINVKEILKSLVAGPVECLEAGLEAMSYPDPAANTQAQ
NRLPMQFHSFDRSVVVPVKKTSPGSLTVHTVGSSSSSSGLTAGSTPHIFAAVSATPRSMI
NTTGRSCTRLVSHSSRGAQNSITTKLERALEKVAPLLREIFVDFAPFLSRTLLGSHGQEL
LIEGTGLVCMKSSTSVVELVMLLCSQEWQNSIQKNAGLAFIELINEGRLLCHAMKDHIVR
VANEAEFILNRQRAEDVHKHAEFESNCAQYAADRKEEEKMCDHLIGAAKHRDHVTANQLK
QKIVNILTNKHSAWGTLAQSQLHDFWRLDYWEDDLRRRRRFVRNPFGSTHLDVTCKSLVE
YGAEEGEVVQFKKVFRSQTVTSQNPETELMLEGDEDAVSLLQEKEMDNLGGPVVLSSPAQ
LVAPLLVARGTLSITTTEIYFEVDEDDLAFRRVDSKVVLAYTEGLHGKWMFSEIRAVFSR
RYLLQNTAMEIFMANRTSVMFNFPDQATVKKVVYSLPRVGVGTSYGLPQARRISLATPRQ
LFKSSNMTQRWQRREISNFEYLMFLNTISGRTYNDLNQYPVFPWVLTNYDSEELNLTLPG
NFRDLSKPVGALNPKRAAFYAERYETWEDDQTPPCHYNSHYSTAASTLHWLVRIEPFTTF
LLSANNNKFDHPDQTFSAIGRSWRNCQRDTHDVKELIPEFYYLPEMFVNSNGYHLGMREG
GTMVWDVDLPAWAKKPEDLVRINRMALESEFVSCQLHQWIDLIFGYKQRGPEAVRALNVF
HYLTYEGSVKLDSITDPLLREATEAQIQSIGQTPSQLLIEPHPPRSSAMHLSPLMFKDQM
QQDVIMVLKFPSNSPVTHIAANTLPHLTTPAVVTVTCSRVFAVNRWHNNVGLRGAPGYSL
EQAYHLPIEMDSLVANNTGSNKRQITDLVDQSIQITTHCFVVTADNRYILVCGFWDKSFR
VYSSETGKLTQIVFGHWDVVTCLARSESYIGGDCYIVSGSRDATLLLWYWSGRHHIIGDN
PNNSDYPAPRAVLTGHDQEVVCVSVCAELGLVISGAKEGPCLVHTITGDLLRALEGPDYY
QYPRLISVSSEGHCIIYYERGHFCNFSINGKLLAQMEVNDSTRAILLSSDGHNLATGGDN
GVVEVWQACDFKPLYVYPGCDAGIRAMDLSHDQRTLITGMASGSIVAFNIDFNRWHHEHQ
NRY
Download sequence
Identical sequences G3PCH8
ENSGACP00000015302 ENSGACP00000015302 69293.ENSGACP00000015302

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]