SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000015308 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000015308
Domain Number 1 Region: 265-320
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000235
Family Ubiquitin-related 0.0092
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000015308
Domain Number - Region: 46-101
Classification Level Classification E-value
Superfamily DUSP-like 0.00549
Family DUSP, domain in ubiquitin-specific proteases 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000015308   Gene: ENSGACG00000011572   Transcript: ENSGACT00000015337
Sequence length 353
Comment pep:known_by_projection group:BROADS1:groupXVII:12630236:12633981:-1 gene:ENSGACG00000011572 transcript:ENSGACT00000015337 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SCQQCLTLEQEEKDNEAVSKMMALDQKNQLLNLFNEKNRPTLNKWPEDTDVLYIVPLFFV
DEWRKFIRRPTKSSPVSNVGNTLLLCPHGGFMFTYDSLINGDGQHVALLWPSEWEVISRL
FIVDQAISIHCFRETSLSDATTQYTTQPDICWECRESFLFQQQRDLREYTQATIYIRKVI
EDQRMMKEAAPELNASSSEAEEDKEEVPKVDGETDLDFSQSQDGAKRLKLSDDGTAASAP
ATNMTKLGGIRRSTRHRKLRGEKALIVSANQTLKELKIQIMHAFSVAPFDQNLSIDGKSL
TDDSATLGSLGVIPESIICLKADEPIADYAAMDDVYQVRMPEEGFKGTGLLGH
Download sequence
Identical sequences G3PCI4
ENSGACP00000015308

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]