SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000015321 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000015321
Domain Number 1 Region: 86-444
Classification Level Classification E-value
Superfamily Cysteine proteinases 6.87e-86
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.00000827
Further Details:      
 
Domain Number 2 Region: 987-1042
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000111
Family Ubiquitin-related 0.0092
Further Details:      
 
Domain Number 3 Region: 471-550
Classification Level Classification E-value
Superfamily DUSP-like 0.0000000275
Family DUSP, domain in ubiquitin-specific proteases 0.013
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000015321
Domain Number - Region: 742-793
Classification Level Classification E-value
Superfamily DUSP-like 0.0523
Family DUSP, domain in ubiquitin-specific proteases 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000015321   Gene: ENSGACG00000011572   Transcript: ENSGACT00000015350
Sequence length 1075
Comment pep:known_by_projection group:BROADS1:groupXVII:12630237:12641064:-1 gene:ENSGACG00000011572 transcript:ENSGACT00000015350 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPRLQLEKAAWRWVETVKPEEIRPEHIELAYRVNLPACKRGTCRRNCKGNPNCLVGIGE
QAWLGDIDENAFHNIDDPNSERRDKNTFVGLTNLGATCYVNTFLQVWFHNLELRRSLYQC
HNSRAEEHDAESGTTEYEPQSICEHLQYLFALLQNSNRKYIDPTGLVKALGLDTGQQQDA
QEFSKLFLSLLEDTLSKQKNPHLQNVIQRQFCGQFSYVTVCNECGRSSALPSRFYELELN
IQGNKNLTECVTEFLKEEKLDGENRYFCESCQTKQCATRRIRLHSIPPTLNLQLMRFVFD
RQTGHKKKLNTFISFPEQLDMGPFLEGKADHKCVYELSAVLIHRGISAYSGHYIAHVKDA
RTGDWYKFNDEEIEKMEGKKLQLGTEEDIAETVKSQTRKPKCSKGYHCSRNAYMLVYKVQ
EEENTDPSWTNVEVPAFLQRLVDQDNHKFEEWCNEMADMRKQSVDKGKAKHEEVKELYEL
LPAKDGEPYEFIPLEWLKKWLEDSTATKEIDNSLFLCCHGKLHPDRVADSKRVSLQAAQL
LYERYGGGPRMDGSSLCRECVGQRCRVLRLKNQLNEDYKEVTNLVKRTLSGEGYWVGKAS
LRSWRQLALEQLEEDEHETKHSNGQTNGQGPHKEFGSELSGGATGDEMKTFNEDIVCCHV
GALSILETERKLVSSEVWTKLREYFPKAPEFTQIQESCQQCLTLEQEEKDNEAVSKMMAL
DQKNQLLNLFNEKNRPTLNKWPEDTDVLYIVPLFFVDEWRKFIRRPTKSSPVSNVGNTLL
LCPHGGFMFTYDSLINGDGQHCSHLHCNLLSRAELNWSHVVLFVLHSVALLWPSEWEVIS
RLFIVDQAISIHCFRETSLSDATTQYTTQPDICWECRESFLFQQQRDLREYTQATIYIRK
VIEDQRMMKEAAPELNASSSEAEEDKEEVPKVDGETDLDFSQSQDGAKRLKLSDDGTAAS
APATNMTKLGGIRRSTRHRKLRGEKALIVSANQTLKELKIQIMHAFSVAPFDQNLSIDGK
SLTDDSATLGSLGVIPESIICLKADEPIADYAAMDDVYQVRMPEEGFKGTGLLGH
Download sequence
Identical sequences G3PCJ7
ENSGACP00000015321 69293.ENSGACP00000015321 ENSGACP00000015321

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]