SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000015363 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000015363
Domain Number 1 Region: 1-100
Classification Level Classification E-value
Superfamily PH domain-like 2.89e-21
Family Pleckstrin-homology domain (PH domain) 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000015363   Gene: ENSGACG00000011619   Transcript: ENSGACT00000015393
Sequence length 289
Comment pep:known_by_projection group:BROADS1:groupVI:15503127:15507269:1 gene:ENSGACG00000011619 transcript:ENSGACT00000015393 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGILYKWTNYMTGWQPRWFVLEGGVISYYDSEDDVDKGSKGSIKMSVCDIKVHPTDTTR
LELIIPGEQHFYVRAVNAAERQRWLVALGSSKAGTLESHRHKDRQLAQSPDCLKTKMSEL
RLYCDLLVQQVQTIQSQHTSDTEETPTSESEESESSSLLSATCATFIRTLEECMTLANQS
MTPDLRPPERVILLLLPMDKTFPAFVSPAQLKRSTSHPGTYSFDRSGVLKEYSSGGQKSS
QRRTRTFSDSSLYDAERLLPTLNGDSSIPEERPDSPKTTPTDTDTDLSI
Download sequence
Identical sequences G3PCN9
69293.ENSGACP00000015363 ENSGACP00000015363 ENSGACP00000015363

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]