SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000015369 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000015369
Domain Number 1 Region: 467-589
Classification Level Classification E-value
Superfamily PH domain-like 3.56e-21
Family Pleckstrin-homology domain (PH domain) 0.000000933
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000015369   Gene: ENSGACG00000011618   Transcript: ENSGACT00000015399
Sequence length 1308
Comment pep:known_by_projection group:BROADS1:groupXVII:12691095:12773098:1 gene:ENSGACG00000011618 transcript:ENSGACT00000015399 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLDPSSSEEEGDEILEVERKEVAAPKSAAGARLSPGRASDGHAGGGLQPRGRGRPSSPSP
SVGSGLQLYVFVMRCIAYPFNAKQPTDMARRQQKISKQHLQTVKERFQAFLNGETQIVAD
EAFINAVQSYYEIFLKSDRVSRMVQSGGCSASDSREVFKKHIEKRVRSLPEIDGLSKETV
LSSWIAKFDTIYRGEEDPRKHQQRMTASAASELILSKDQLYEMFQQILGIKKFEHQLLYN
ACQLDNPDEQAAQIRRELDGRLQMADQIARHGGRFPRFASREMEAMFIEELRSSVNLLMA
NLESMPVSKGGEFKLQKLKRGHNASIMDMGQEDENTLSKSDVVLSFTLEVVIREVQGLRS
LTPTRIVYCPREVEGGHKRQTDQAEPLTYVRPPWGTQGDFTTTQPLPAVKVKLFTESTGV
LALEDKELGKVVLHPTPNSPKQSELHKMTVSKGCPDNDLRIKLAIRMDKPQNMKHCGYLW
AIGKILWKRWKKRYFVLVQVSQYTFAMCSYREKKAEPVELLQLDGYTVDYTDPQPGLDGG
RTFFNAVKEGDTVIFASDDEQDRILWVQAMYRATGQSHKPVPPTQVQKLNSKGGTAPQLD
APISQFFSYKDADRAQKHGMDEFISANPCNFDHGSLFELVQRLTLDHRLNDSYSCLGWFS
PGQVFVLDEYCARYGVRGCHRHLCYLSDLLERAENGAMIDPTLLHYSFAFCASHAHGNRP
DGIGTVTVEEKEHFEEIKERLRVLLENQITHFRYCFPFGRPEGALKATLSLLERVLMKDI
VTPVPQEEVKAVIRKCLEQAALVNYQRLSEYAKLEDKSTVTENNLKDPENVGRLVTPAKK
LEDNIRLAELVIEVLQQNEEHHAEVSASKVEAFAWWSDLMVEHAETFLCLYSADMDAALE
VQPPDSWDSFPLFQLLNDFLRMDYNLCNGKFHRHLQDLYAPLVVRYVDLMESSIAQSIHR
GFQRESWEPVKSITSNLPNVNLQMPKVPNLTVQSVNLPQMPNFSAPDWMTANSDSDNGSG
TSEDLFWKLDALQTFIRDLHWPEEEFSKHLETRLKLMSSDMIESCVKRTRAAFEAKLQKS
SRATDFRVPQSICTMFNVMVDARAQTAKLCAVDLGQERQYHSQINDLIEETVKEMITLLV
AKFVVILESVLAKLSRYDEGTLFSSFLSFTVKAASKYVDVPKPGMDVADGYVTFVRHSQD
MLREKVNEEVYIERLFDQWYTSTMNLLGTWLTDRMDLQLHLHQLKILIRVVKKKYRDFRL
QGVLDSTLNSKMYETVRNRLTLEEATASVREGGLQGISMRDSDEDDDN
Download sequence
Identical sequences G3PCP5
ENSGACP00000015369 ENSGACP00000015369 69293.ENSGACP00000015369

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]