SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000015389 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000015389
Domain Number 1 Region: 58-251
Classification Level Classification E-value
Superfamily Sec7 domain 4.19e-79
Family Sec7 domain 0.0000000113
Further Details:      
 
Domain Number 2 Region: 259-380
Classification Level Classification E-value
Superfamily PH domain-like 3.48e-34
Family Pleckstrin-homology domain (PH domain) 0.000000561
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000015389   Gene: ENSGACG00000011632   Transcript: ENSGACT00000015419
Sequence length 393
Comment pep:known_by_projection group:BROADS1:groupXI:10460880:10482110:1 gene:ENSGACG00000011632 transcript:ENSGACT00000015419 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDEDNQVPEDLSVEERDELSNIRRRKKELLDDIERLKFEIAEVMTEIEQLTCVGESKTTQ
RNKQIAMGRKKFNMDPKKGIQFLLENDLLQHTPEDISQFLYKGEGLNKTAIGDYLGERDD
FNIKVLQAFVELHEFADLNLVQALRQFLWSFRLPGEAQKIDRMMEAFASRYCQCNPGVFQ
STDTCYVLSFAIIMLNTSLHNPNVRDKPPVERFISMNRGINEGGDLPEDLLRNLYDSIKS
EPFKIPEDDGNDLTHTFFNPDREGWLLKLGGRVKTWKRRWFILTDNCLYYFEYTTDKEPR
GIIPLENLSIREVEEPRKPNCFELYNPNHKGQVIKACKTEADGRVVEGNHVVYRISAPTA
EEKEEWIKSIKASISRDPFYDMLATRKRRIANK
Download sequence
Identical sequences G3PCR5
ENSGACP00000015389 ENSGACP00000015389 69293.ENSGACP00000015389

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]