SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000015446 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000015446
Domain Number 1 Region: 18-82
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000000336
Family Ras-binding domain, RBD 0.00011
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000015446
Domain Number - Region: 301-386
Classification Level Classification E-value
Superfamily Tropomyosin 0.0147
Family Tropomyosin 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000015446   Gene: ENSGACG00000011681   Transcript: ENSGACT00000015477
Sequence length 430
Comment pep:known_by_projection group:BROADS1:groupXIX:14892428:14895854:1 gene:ENSGACG00000011681 transcript:ENSGACT00000015477 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IKGLILAFWENYKTAVEFCKNIIFFLKPTLLFTGRTGRYTLVEKWRDSERHLAPHESPVA
SLNTWGQYAGDVQLILRRTSPSLTERSSSEEPPLREPERSANRQSLLPLAKLHHSFYRSH
LSRREPGPKTLLFQGCPQRAPVYMNSWGSTTSTTPNQRATNRDSTAWARGTCRMEDLVRL
VGLQRETLNVLQKKLEAYEAELQAWADGTEERVEEILRLEKHLRKTTLRWRKRSFGSTEL
QIELESERQLEERLHELVGRLQGCEVEIEEKLSMVQSVEAGLEEERLQRQRQETQWVSEA
EARSQVLRAKTELKAQERQAVQLESSCRAVDRSLGQSTKNLQDMQHELEQLTKELRQVNL
QQFIKQTGTKVTVLPAEPSEDESTHSTHVKDLVPLSGSLKRPVSSHAMSSHLRILHSPLT
SGLNPEGIYV
Download sequence
Identical sequences G3PCX2
ENSGACP00000015446 ENSGACP00000015446 69293.ENSGACP00000015446

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]