SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000015453 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000015453
Domain Number 1 Region: 320-622
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2e-90
Family Protein kinases, catalytic subunit 0.0000000217
Further Details:      
 
Domain Number 2 Region: 156-282
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.28e-36
Family Synaptotagmin-like (S variant) 0.00000398
Further Details:      
 
Domain Number 3 Region: 23-85
Classification Level Classification E-value
Superfamily Cysteine-rich domain 3.44e-18
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0027
Further Details:      
 
Domain Number 4 Region: 96-152
Classification Level Classification E-value
Superfamily Cysteine-rich domain 7.18e-18
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000015453   Gene: ENSGACG00000011652   Transcript: ENSGACT00000015484
Sequence length 670
Comment pep:known_by_projection group:BROADS1:groupXI:10494542:10558232:-1 gene:ENSGACG00000011652 transcript:ENSGACT00000015484 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADHLLHYSDSAGVGNRFARKGALRQKNVHEVKNHKFTARFFKQPTFCSHCKDFIWGFGK
QGFQCQVCCFVVHKRCHEFVTFSCPGADKGPDTDDPRSKHKFKIHTYGSPTFCDHCGSLL
YGLIHQGMKCDTCDMNVHNQCVVNVPSLCGTDHTERRGRLFLKIEVSLDRLHVTVGEARN
LIPMDPNGLSDPYVKLKLIPDPKNETKQKTRTIRSSLNPCWNESFSFKLKASDKDRRLSI
EVWDWDRTTRNDFMGSMSFGVSELIKAPNCGWYKLLNQEEGEYYNVPIPEMDDVNLELRQ
KFEKAKLGHGKKVITPSDHRRFSLPSGNMDRIRLNDFNFLSLLGKGSFGKVMLAEMKSTE
ELYAIKILKKDVVIQDDDVECTMVEKRVLAQRDKPPFLTQLHSCFQTVDRLYFVMEYING
GDLMYHIQRMGKFKEPQAVFYAAEIAVGLFFLHRKGIIYRDLKLDNVMLDSEGHIKIADF
GMCKENMYEGMSTRTFCGTPDYIAPEIIAYQPYAKSVDWWAYGVLLYEMLAGQPPFDGED
EDELFQSIMEHNVSYPKSMSKEAVSICKGLMTKHPSKRLGCGSEGERDIREQAFFRRIDW
ERLANREIQPPFKPKVGGKGAENFDKFFTRTQPVLTPPDQLVIANIDQSEFAGFSYINAQ
FIHPSLHSVV
Download sequence
Identical sequences G3PCX9
ENSGACP00000015453 69293.ENSGACP00000015453 ENSGACP00000015453

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]