SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000015460 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000015460
Domain Number 1 Region: 67-205
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.44e-35
Family Regulator of G-protein signaling, RGS 0.0000043
Further Details:      
 
Domain Number 2 Region: 721-803
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.41e-21
Family DIX domain 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000015460   Gene: ENSGACG00000011694   Transcript: ENSGACT00000015491
Sequence length 804
Comment pep:known_by_projection group:BROADS1:groupXI:10642924:10653747:1 gene:ENSGACG00000011694 transcript:ENSGACT00000015491 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRALMDHISGSFREDAPRPPVPGEEGEPRRYPGKPAMTKPPQKAEVVLGSSARRNQDGL
GEPEGSASPDSPLSRWNKSLHSLLGDQDGALLFRTFLEREKCVDALDFWFACNGFRQMDP
RESKTQRVAKAIYKRYIESDGVVAQQLKPATKTFIRDNIKKQHVDSAMFDQAQTEIQADM
EENAYRMFLSSGVYLEYARTGGETPNHVVQVGCGYMPTLIEEEVWSCDFRVKAPPGCASV
NAQAVTASARAVEVMERGHRSYKRGDHAGSFAPATSTNDSEVSSDALTDDAMSVTDSSVD
GIPPYKLGSKKQLHRDMQRNMRMNSQVSLPAFPRTCWPPKEVVPMKPSEFAAQLISRLES
LKRKQDTTNSLEEIQEEEERDEAETALSPHPFALLPESSDEDPQAILDEHLSRVLKTPGC
QSPAVVRRSLCSGSPECRPIARAGFGTKAPAGPCTPCVSSPDQGANSPTPGPGRSFVSRQ
NTKHIHHHYIHHHGGPKTQEQIEREAALRVHGLCEGGGGSDCQPYQRSRSLGREMCGAAA
TGGSVGRSSSLSRRACRSGAEDGVAERCVEDCGPPLQLPSNTTDSTQNVLQWILESKRQS
RHKSHSVQSVKKTFGGSSAQTHTWGGGGSCGHLRSHQPAQPFIQDPAMPPPPPPNTLAQL
EEACRRLGEVSIKPAKQRHPMSGLQQEKSHPVQEYDASSVTLLRTRRPPHMAKEARKGSG
GETVVTYFFCGEEIPYRRNMKSHCLTLGHFKEQLRKKGSYSLRYYFKKASDEFACGAVFE
EVSDDGCSLPTYQGKILGKVERME
Download sequence
Identical sequences G3PCY6
ENSGACP00000015460 ENSGACP00000015460 69293.ENSGACP00000015460

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]