SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000015486 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000015486
Domain Number 1 Region: 10-188
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 5.89e-34
Family DBL homology domain (DH-domain) 0.00047
Further Details:      
 
Domain Number 2 Region: 207-352
Classification Level Classification E-value
Superfamily PH domain-like 2.16e-20
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000015486   Gene: ENSGACG00000011708   Transcript: ENSGACT00000015517
Sequence length 375
Comment pep:known_by_projection group:BROADS1:groupXIX:14961456:14965830:1 gene:ENSGACG00000011708 transcript:ENSGACT00000015517 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QVFSATLTNLQVRHCLADVDSWRLFANLNELCLVSFGFLNNLLRAIKDTLEITHGGGSTL
PELLSKAFQESLCHCLQKYCLNYSTALLYLDSLKPREDFGSYVKWCERNEQCRRLQLRDL
LVAPLQRLTRYPLLLRNIAKRCPREDEAAGLQVITEQVDTSICDLEGKVKWLDNYQKVKQ
LRDALVWLPVWERDKRAFVPENLKHLLKAVTLENLISHRSLLHEGKVMLSENTKLIDVYL
FLFDEFLLITKIKRNKKRSIGPEQNPLRMPQNLELDQLLKDGCTFVVLDQPVSLDRIQLK
NIDQLNASASGLPHSFIIMHQNRYQQCIGAFILQAASEAAKRAWMSTIEGAVTALLASPQ
PRVKSSSLWLESSQI
Download sequence
Identical sequences G3PD12
ENSGACP00000015486 69293.ENSGACP00000015486 ENSGACP00000015486

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]