SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000015502 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000015502
Domain Number 1 Region: 1281-1339
Classification Level Classification E-value
Superfamily Eea1 homodimerisation domain 1.44e-20
Family Eea1 homodimerisation domain 0.0000937
Further Details:      
 
Domain Number 2 Region: 1318-1401
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.53e-20
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0000789
Further Details:      
 
Domain Number 3 Region: 585-810
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000915
Family Tropomyosin 0.003
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000015502
Domain Number - Region: 232-341
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00133
Family Myosin rod fragments 0.0039
Further Details:      
 
Domain Number - Region: 434-627
Classification Level Classification E-value
Superfamily Tropomyosin 0.00366
Family Tropomyosin 0.0021
Further Details:      
 
Domain Number - Region: 958-1048
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00902
Family Myosin rod fragments 0.0068
Further Details:      
 
Domain Number - Region: 345-432
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0209
Family Myosin rod fragments 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000015502   Gene: ENSGACG00000011713   Transcript: ENSGACT00000015533
Sequence length 1403
Comment pep:known_by_projection group:BROADS1:groupXIX:14968720:14982672:-1 gene:ENSGACG00000011713 transcript:ENSGACT00000015533 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRRILQMTPGKGGSQNAESEQPSTDLNHDQTSEGFICPQCMKSHNSAEELFKHYELFHD
TGDLPAHMAPTREDLTMLRQEVQDLHTSLKEEKWFSEELKKELDKVQGHLKQNDGPMSPD
DSGREYYRLEKKLNEAETEKFNIKQMKDLFEQKAAQLATEIVDLKSRYDEEKSLREAADQ
RLGKLTEQLQKEKEENERLQTELLQRPGVEDVEVLQKELVQVQTLMDSMTREREAESERL
QSRYEQLQADYTTSEMTISQLEAELEKGPQEAAVYTQQIHQLQSNLNNLQQQSQSLSEKL
ARKEKEYQELEEHLGAERAAKKGAEGSLRERELEAQELQARATGAEGYLTKAQTELAERA
EEVAKLKKEITELEVKHAELKVERKQLQQQREEKDNQGAQQQAEISQLHAKLLEAERQLG
EVQGRLKEQRQLSGEKLKDREQQAADLQLKLSRAEEQLKESGSKNTDVQHQLEKAKQQHQ
ELQALQQNTNGKLREAQNDLEQVLRQIGDKDQKIQNLEALLQKSKDIVSQLETERDDLCA
KIQAGEGETAVLNQLKEKNHGLQEQVTQLTDKLKNQSESNKQAQDNLHKQVQEQKSLLRS
AQDRALTLETSVTEVTTQLAESKEKAAQLDAQQLKAKTEMLLSAEAARAAQKANLENSLE
TAQHALQDKQQELNEAQTKIEEQAQRLKERQAQCTQLDASLKECKDKLMASEQRIEQLEG
LNKKKLESQVGELQVTQDQVQQEVQKLQKEGSEVKRKAKELQLSLETEKARATTLQEELK
KKTAALSDTQQQLERSEQDQAALKVNLDTVMVEGKTKHADLDRRAQSLAADLQKAQQEKD
AQRKELANTQDSLGKANKALKESLGVLDTERKKHKSVMEEKDKSNEKARQELLKINEGIA
KSMKESQKQLEQMGEAEKRLKVQLATLEQQRSDSEGALTEKEKELEKLQAQLKAATGSFE
EEMKKLKGQVAELQEVNVKKTEEESNLRAQVSGLGNELASENSRTTELQKALGESQESLT
KLQSDFYGKESEVSALRQDLKASEEKLNLGLEELAANRSHQAGLEAQVQDLQKGRGSLEQ
VLERRDVKLQQQEQTLKAVQKQQGEVKEQLEKERSNVEELKKAKTVLENNSNKLTSQLKT
LSERREKELGELREAKQLLIQQKLELQGQTEAAQRTLEQEQKEHQVTRDSRGQREEQLLA
QTKKVQDQLKSAEKRAREETVKRGEETVAKMEAQVTALNENVATLKREWQGSQRRVGELE
KQTDELRGEIAVLEATVQNNQDERRALLERCVKGEGEMEKLQAKMVELRRKLDDTTAAMQ
ELGRENQSLQIKQCQSLTRKWAEDHEVQNCMACGKGFSVTVRKHHCRHCGNIFCAECSMR
NAFTPSSKKPVRVCETCFDELQG
Download sequence
Identical sequences G3PD28
69293.ENSGACP00000015502 ENSGACP00000015502 ENSGACP00000015502

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]