SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000015510 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000015510
Domain Number 1 Region: 213-356
Classification Level Classification E-value
Superfamily PH domain-like 5.53e-40
Family Third domain of FERM 0.00000899
Further Details:      
 
Domain Number 2 Region: 109-214
Classification Level Classification E-value
Superfamily Second domain of FERM 7.85e-37
Family Second domain of FERM 0.00000329
Further Details:      
 
Domain Number 3 Region: 32-108
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.98e-23
Family First domain of FERM 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000015510   Gene: ENSGACG00000011718   Transcript: ENSGACT00000015541
Sequence length 794
Comment pep:known_by_projection group:BROADS1:groupXVII:13225419:13246380:1 gene:ENSGACG00000011718 transcript:ENSGACT00000015541 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ETDDMSEKTSPNKNLKSPQKGSKRLKTAPFKMTLLDSSEFEGEIEKHSKGQTLMDMVCEH
LNLLEKDYFALTFADADTQKNWLDPSKEIKKQMRNSPWHFAFSVKFYPPDPSQLTEDITR
YYLCLQLRDDMLSGRLPCSFVTHALLGSYSVQAELGDYDQDDHGADYVSDFRFAPNQTRE
LEERVMELHRNYKGMTPAEAEINFLENAKKLSMYGVDLHHAKDSEGIDIMLGVCANGLLI
YRDRLRINRFAWPKILKISYKRSNFYIKIRPGEYEQFESTIGFKLPNHRAAKRLWKVCIE
HHTFFRRLVSPEPPPKGFLVMGSKFRYSGRTQAQTRQASALIDRPAPHFERSTSKRYLLS
RSLDGAEFTRPVSGTCENHDGLLELDEEDRDQERGEDTGQDYDGDVTPSRKKEIMSDQEA
TPRHKREFLDKSKDVMLKHQASINELKRTLREPSSKLSNREKRLSSASPNGTPEKKAVSG
GTQDKSQSKPSHASTPEANVDAPAASRQRDTLACMRETQLGIERKCSSMTVSSTSSLEAE
VDFTVVMDLHSGSEDFSRCMSEMGGRERQPEEASAVSMAHMLKRADSKAETHTNGSEVKP
AGANVSSQQPSTDSVQYKTITISALALRKKLSKCHVLDTIVDTTLSTSIGGHAAYLGLQL
HAGFPPPTTQCVKRKMKSALRSIFWGENFRVVGPREAPAVLKVKAGSQGRESVVSPLTIT
ADSVTSATTTQVTKTVKGGFSETRIEKRIIITGDEDVDQHQALAMAIQEAKQQHPDMLVT
KAVVIRESESPTEE
Download sequence
Identical sequences G3PD36
ENSGACP00000015510 69293.ENSGACP00000015510 ENSGACP00000015510

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]