SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000015517 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000015517
Domain Number 1 Region: 437-539
Classification Level Classification E-value
Superfamily PH domain-like 6.82e-19
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000015517   Gene: ENSGACG00000011727   Transcript: ENSGACT00000015548
Sequence length 888
Comment pep:known_by_projection group:BROADS1:groupI:13903005:13923358:1 gene:ENSGACG00000011727 transcript:ENSGACT00000015548 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNVESQNGDHTLYRNEHGYLSRKHMSRSLRISNKQSRRSRHASSGKIEHRNSETSTRSS
STPSIPQSLADNGLEPFDETNILPDFGSPIWVDRVAMNLRPVSFHNDLANPSVHMNTMHV
TLPGPTAEEVQDEDVYAGEVTYLQKTRDCSKETASFKKKRSKSADMWRDDSLEFSLSDLS
QDHLTSTEEIIDPQESKRDFTDGKGHLQCSPTDCGDRANSLDELCSQKCPPARRQPHSRY
AKWHDTNRVIREGEDDKMISPSEEDGNSYGAYTLPCRRSHCLSEGLSSHQAAMCASMQGR
RAQTIQDVTAGEGSEYEDSGIDGVTVEAEQQSRRYKTMSASFSVCSAAGRSMFAGSDSGS
SSGGGPSECVQGVYENFRQELEMSSCQTDSLEEAGSALSDEQSTMSSTYQSDPLLSVTQG
MVRKAGRLAVKNFLVHKKNKKVESATRRKWKSYWVSLKGCTLFFYETDGRSGIDNNSIPK
HAVWVENSIVQAVPEHPKKDFVFCLSNSLGDAFLFQTCSQTELENWITAIHSACATAVAR
QHHREDTVRLLRAEIKKLEQKIDMDEKMKKMGDMQLSAVTDTKKRKTILDQIFLWEQNLE
QFHMDLFRFRCYLASLQGGELPNPKRLLAVASRPTKLAMGRLGIFSVSSFHALVAARSEN
GVRRRTQAMSRSCSKRKKSRKDFLKTVHSILREKHRRQLLKTESLPVKQQYVPFGGKRLC
ALKGARPAINRAASVPTRTLGRRKLVRNRFTIDTDIVFDGEPGQELQQAELAGDTDRWVE
QQFDLEEYEDKEVVKETDILSDEDDELCQTPGASSAEAELRAPVMALSLESEETSEGESL
QSPKASSSPDDEQSAAANNSVEEDQKQTERDEIWVRRQQSGSSPESGT
Download sequence
Identical sequences G3PD43
ENSGACP00000015517 69293.ENSGACP00000015517 ENSGACP00000015517

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]