SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000015524 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000015524
Domain Number 1 Region: 268-430
Classification Level Classification E-value
Superfamily PH domain-like 1.96e-72
Family Pleckstrin-homology domain (PH domain) 0.00000015
Further Details:      
 
Domain Number 2 Region: 55-274
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 9.03e-54
Family DBL homology domain (DH-domain) 0.0000000144
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000015524   Gene: ENSGACG00000011727   Transcript: ENSGACT00000015555
Sequence length 620
Comment pep:known_by_projection group:BROADS1:groupI:13915304:13923358:1 gene:ENSGACG00000011727 transcript:ENSGACT00000015555 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVLKWNKHSKRSSDSVYDMLHLSTEQVAAFCRSLHDMNPSECVSSSPSPDSPFPPPATL
RQLSDADKLRKVICELVETERTYVKDLNCLIGRYLTPLQKETFLTQDELDVLFGNLLEMV
EFQLEFLKTLEDGTRLVPDLEKLERVDQFKKILFSLGGSFLYYADRFKIYSAFCASHTKV
PKVLVKAKTDPDFKAFLEERNPKQQHSSTLESYLIKPIQRVLKYPLLLRELYSLTDPDSE
EHYHLDVAMKAMNKVASHINEMQKIHEEFGAVFDLLITEQSGEKKEVADLSMGDLLLHTS
ATWINPPASLGKWKKEPQMATFVFKMAVVFVCKEGSKQKKKMGGSHRVSVSSEEKDPFRY
RHMIPTSSLQVRSLANADGEGSAVCEIVHTKSESEGRPERTFQLCCSSPESRKDFLKTVH
SILREKHRRQLLKTESLPVKQQYVPFGGKRLCALKGARPAINRAASVPTRTLGRRKLVRN
RFTIDTDIVFDGEPGQELQQAELAGDTDRWVEQQFDLEEYEDKEVVKETDILSDEDDELC
QTPGASSAEAELRAPVMALSLESEETSEGESLQSPKASSSPDDEQSAAANNSVEEDQKQT
ERDEIWVRRQQSGSSPESGT
Download sequence
Identical sequences G3PD50
ENSGACP00000015524

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]