SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000015547 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000015547
Domain Number 1 Region: 10-173
Classification Level Classification E-value
Superfamily RUN domain-like 2.88e-37
Family RUN domain 0.00063
Further Details:      
 
Domain Number 2 Region: 1358-1472
Classification Level Classification E-value
Superfamily Supernatant protein factor (SPF), C-terminal domain 1.22e-28
Family Supernatant protein factor (SPF), C-terminal domain 0.0019
Further Details:      
 
Domain Number 3 Region: 1159-1234
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 2.49e-17
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000015547   Gene: ENSGACG00000011746   Transcript: ENSGACT00000015578
Sequence length 1474
Comment pep:known_by_projection group:BROADS1:groupVIII:15118216:15127957:1 gene:ENSGACG00000011746 transcript:ENSGACT00000015578 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AAATVGESQLQRIIRDLHEAVAELAKEYRESGEPITDDSTTLHKFSYKLEYLLQQFDQKD
KTTFLGTKKDYWEYFTDCLAKIKGANDGIRFVKSITELKTSLGKGRAFIRYSLVHQRLAD
TLQQCLMNHRVTSDWYYARSPLLKPHLSVDIISHLYELNEVQFDVASRGHDLDAAWPTFA
SNRRTLGSGSSPGHMWKPPSRSSSINSLASTYSQGHGLLSDLNESLPACNEDVSTVDGLR
LELDQSELKQRELLDKVQQMGEEGAELRDVVVQLQRQLDVSLAAQEEQRGLHGDLKALKG
REEDLSREVEALRTGKKAKEAEQQLVQERLAAAERKNLELLAKLDGVLNEKGQQATSHFD
SAQKIHKLLDRLKEAERGKMEAVAEMEEKKRLAERLEDELRVKETAAKRLETKLAALVAS
ASEEKAKLEAEVEEQRKAIDKLQGSLTVREKETSNLQRQLLDLQGSLEEKEKEALEVKIS
AQKDKGLKESLEAEVTALKEHLERKEAEFTSSCKTLQQLEAKNQSLTAERDQLTTNLVEL
EGDVKDQAMKIEDYKTQCTNLIELNRKLMTTVKRSEELKKEMAETRLDDTKMTVEEKEKC
LREDNRKLDESLQRAAMAAKLSEDASKRLERENHSLREEQDTVKAALSRMQADLKSVNAQ
IGDLEKNLGASRKNAASLQEQLLAKEAQLESTEKNLAELLSSFKSLEAREKELEIAKADA
EATCAKQSEVIERVTSDKQAMEKSQLERSAVQAKANQEVAGKLEGQLEVCMKDVSRLQAE
ILDLRVRAQRSEEERMKSQAQLEVTEAQRDELRTLTEHLKSQTQALNQRHVADLMECKKR
EQALMEQRDGEVAAHAELSISAAAAREELSGLKAENSRLSSENAETREVLHRANTEMAEL
GISICKLSAEKEEVREQWAGDAARIEELEKELHRLEEGRAELQLENTKLKEELTQKGTLP
GTIVELQQQLDKARNQLKSVKDANQEEVEAVKFQMSSESMNHQLQVKSINEQLDKMKAEL
QKELKHASSLQAKVSELEAANEEYLQLTGEKDAHITKTETSIRESESEIQQLRNAETNAA
EAHSALLIVCEELKQKLNAAEADKQSQNLKMTAEVDDLNRTKVNLEERLIELIRRDKDAL
WQKSDALEFEQKLRAEERWWLVDKETTQCLGCQGQFTWWLRRHHCRLCGRIFCYYCSNNF
VMTKHSGKKERCCRECYTQHSVVVERFTQAELSPTDMQPPPPGAGPQPPHEPAPYKPTPS
VTVSDPSSRSDDGVFDIITEDEVNGVYDSDTTSQTTAGSLEGEQDRPPAGALGTRDGARD
DSEEHVATVQDSEINLLQSGDLTMDVPLSIEDISKFGEGSREIFIKSSCYSVITVAVGDR
GPTISWTFSSEPKSISFSVVYRESADSHVEHSKVLIPLTRCNSHKETVQGQLKVRHPGLY
TLIFDNSFSRFISKKVLYHLTMERPIIYDGSDLP
Download sequence
Identical sequences G3PD73
69293.ENSGACP00000015547 ENSGACP00000015547 ENSGACP00000015547

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]