SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000015552 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000015552
Domain Number 1 Region: 575-687
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 8.76e-40
Family Pyk2-associated protein beta ARF-GAP domain 0.00026
Further Details:      
 
Domain Number 2 Region: 68-232
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.59e-28
Family G proteins 0.0000023
Further Details:      
 
Domain Number 3 Region: 327-397,515-562
Classification Level Classification E-value
Superfamily PH domain-like 4.75e-17
Family Pleckstrin-homology domain (PH domain) 0.018
Further Details:      
 
Domain Number 4 Region: 705-797
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000000234
Family Ankyrin repeat 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000015552   Gene: ENSGACG00000011751   Transcript: ENSGACT00000015583
Sequence length 829
Comment pep:known_by_projection group:BROADS1:groupXII:15456050:15473253:1 gene:ENSGACG00000011751 transcript:ENSGACT00000015583 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNSSSKSANSCAIKAEIKRYVSLQNALNRLSKQFERVTDQQLRAGLKVYLHSIQVNIANS
QEWTLSRSIPELRLGILGSIKSGKSALVNKYITGSYVALEKPEGGRYKKELLVDGQSNLL
LIREENGPPDAQFSSWVDAVILVFSLENEGSFQELYQLYSQLSAHRTDIPVIVVGTQDKI
SSTNPRVIEDQRARQLCVDVRHSLFYETCATYGFNVDRVFSEAAQKIVAQKKQAALQACK
SLPNSPSHSGGSTPGSASFPGQASNGPSCGYAYSLPSTPVIAHRDLRVAQAEGGGSVNSR
SLKGIPRRPSLFKNRDSDKKSGDPKGDLSGARGVPIKQSILWKRSGSSLNKEWKKKYVTL
SNNGTLSYHSSSSDYTQNIHGKEIDLLRVTVKVPGKRPPRAVAPAGPSPVPPGAAPGVNG
LSKDPTATEGTSTVPQLCPATLSVVDDRSGVLLPHGGDRGLQRCASSLSAKAGAAGPFAG
KDPGQSSPMSDRKKNRRKKSMNQKGDASATAADEENADFIIVSFTGQTWHFEAPSLEDRD
SWVSAIESQILASLQSCESGRSKARRSSQSEAVALQAIRNAKGNHLCVDCEAPNPTWASL
NLGALICIECSGIHRNLGTHLSRVRSLDLDDWPGELTQVLAAIGNHTANNLWESCTQGRT
KPTPTATREERESWIRAKYEQRAFVPPLQPPPGPQLPGDDMPAWLLSAVTERDLPRLLLL
LAHSTKERINAQPTGETSPPRSALHAACQLGDVVMTQLLVWYGIDVKAKDNQGQTAMKMA
RKIGSKGCIDILLQHGCPNETSPTTATPVLSRRSSTASLGRTSSSRKRV
Download sequence
Identical sequences G3PD78
ENSGACP00000015552 69293.ENSGACP00000015552 ENSGACP00000015552

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]