SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000015613 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000015613
Domain Number 1 Region: 565-1035
Classification Level Classification E-value
Superfamily Ras GEF 7.32e-134
Family Ras GEF 0.000000000000648
Further Details:      
 
Domain Number 2 Region: 6-176
Classification Level Classification E-value
Superfamily Histone-fold 3.05e-55
Family TBP-associated factors, TAFs 0.000000395
Further Details:      
 
Domain Number 3 Region: 208-397
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.14e-41
Family DBL homology domain (DH-domain) 0.000000183
Further Details:      
 
Domain Number 4 Region: 416-572
Classification Level Classification E-value
Superfamily PH domain-like 4.11e-34
Family Pleckstrin-homology domain (PH domain) 0.00000467
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000015613   Gene: ENSGACG00000011795   Transcript: ENSGACT00000015644
Sequence length 1301
Comment pep:known_by_projection group:BROADS1:groupXV:11616270:11640285:-1 gene:ENSGACG00000011795 transcript:ENSGACT00000015644 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQPQQIYDFSSDENSHKWRGLFVQALRKVQKQVHPNLTAKEDALQHIEELILQLLNMLCV
AQPRSVHDVEERVQKTFPHPIDKWAIADAQSAIEKRKRRNPLLLPVEKIHPLLREVLGYK
VDYNVSLYIVAVLEYISADILKLAGNYVGNIRHYEISQQDIKVSMCADKVLMDMFDQEED
IGLMSQCTEEPSSSGEFTYDDLVRLEIAEERQYLRELDLIIKVFRQHFLSNPKIFTPQDV
EVIFSNILDIHELTVKLLGLIEDAVEMTADGSPHPLVGSCFEDLAEEQAFDPYETLSQDI
LSKDFHEHFNNLMARSTAGLYFQSVADGFKEAVQYVLPQLMMVPVYHCMHYFELLQQLQE
RSQDQDDRECLKQAITALLNLQCSVERIYAKHQPRRKPGEPMYRLYSRQVRSKQLAIKRM
NEIQKSIDGWEGKDIGQCCSEFILEGPLVRAGAKHERHNFLFDGLMISCKANQSSRLPGS
GSGAEYRLKEKFVLRKIRIVDREDSGDQRHAFELIGKDENCAVFCARTAEDKAAWMAGLV
TLQYRSTLDRMLDTVLQHEEQAHPLRLPSPEVYRFAVQDSEENIVFEDKVQSKTGIPIIK
AGTVVKLIERLTYHMYADPNFVRTFLTTYRSFCKPQGLLTLLIDRIEIPEPEPTEEDRQA
LWNGDQPMAAELQRFRKEYVQPVQLRVLNVFRQWVEHHFYDFENDPELRSRLEEYISTKI
QLRGKSMRKWVESINKIIRRKLQTQSNGVSHNITFESPPPPIEWHICRVGHVDTFDLMTL
HPIEIARQLTLLESELYRAVRPSELVGSVWTKEDKEKNSPNLLRMIRHTTNLTLWFEKCI
VETMNLEERVAVLSRVIEILQVFQELNNFNGVLEVVSAINSVPVYRLDHTFEAIPERKRK
ILEEAVELSQDHFKKYLLKLKSINPPCVPFFGIYLTNILKTEEGNPDFLKRHGKELINFS
KRRKVAEITGEIQQYQNQPYCLKVEHDIRRFFENLNPMDNRSEKEFSDYLFKMSLDIEPR
NCRQAPRFPRKTVYPLKSPGIRPVRTSTSGTLKCHPVPLEREPPHKITFRSIAETEPELP
ASASVPTSPNTPTPPQSASSDLSSVFIDHDLSSSYGGSNSIFAPVLLPPSTSRSDSPPAI
PPRLPPHLPRTQPRPLVYNGPPMDGPLPSPPPPPPPPRDPLPDTPPPVPQRPPEIFINYP
LNMQPSPVGRYHWDFSSSPSSPNTPPSTPSPRIPRRSCPLSASQNSLYPLPVSFMAPPVP
PRHNCSPQLPKLPPKTYKREMLLQPPPPLQGLSLVENTDGS
Download sequence
Identical sequences G3PDD9
ENSGACP00000015613

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]