SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000015642 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000015642
Domain Number 1 Region: 319-657
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 1.45e-130
Family Mammalian PLC 0.00000000273
Further Details:      
 
Domain Number 2 Region: 893-956,1001-1167
Classification Level Classification E-value
Superfamily C-terminal domain of PLC-beta 3.27e-62
Family C-terminal domain of PLC-beta 0.0000954
Further Details:      
 
Domain Number 3 Region: 18-146
Classification Level Classification E-value
Superfamily PH domain-like 5.84e-40
Family Pleckstrin-homology domain (PH domain) 0.0000747
Further Details:      
 
Domain Number 4 Region: 148-316
Classification Level Classification E-value
Superfamily EF-hand 1.22e-28
Family EF-hand modules in multidomain proteins 0.00012
Further Details:      
 
Domain Number 5 Region: 677-796
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 5.61e-22
Family PLC-like (P variant) 0.000097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000015642   Gene: ENSGACG00000011822   Transcript: ENSGACT00000015673
Sequence length 1168
Comment pep:known_by_projection group:BROADS1:groupVI:15693807:15709657:-1 gene:ENSGACG00000011822 transcript:ENSGACT00000015673 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASAQPGVHALKLQPPFVSQTLRNGSNFIKWDEDLSTVTPVTLHVDQHGFYLYWTDQNKE
TELLDLTIVKDVRTGRSTKTPKETKLRELLDIGNLVGRLENRMVTVVTASDLVNVNQLNF
IASQEDEAKVWCEELFSLSSNLLSLNLNRDQSLLKAYVRLTLQPNAEGRIPVKKPPFHLF
LQKRKKGETPLEDFRLPPPTAGDGIKLEDLTLEVYRSFLDSLCPRPELSNIFKLQGWGDG
TLSLDQMTEFVNNKQRDPRLNEILYPPLRPAQTLALMERYQQDPAQLEQAGVITLQALSS
YLSSDENGVIPPEKLDQSEDMSYPLSHYIINSSHNTYLTAGQLAGSSSVEMYRQVLLAGC
RCVELDVWKGRTAEEEPVITHGFTMTSEIPFKEVIEAIAECAFKTSPFPVILSFENHVDS
LKQQAKMAEYCQSIFGDALLIDPLDKYPLESGVPLPSPQELMGKILIKNKKSHKPPNNTD
AKRPADQPANQSSEPAFPSNNAGEIEAESEEEDDDEDDDGKKVSGDVGSAEREAVATEEM
STLVNYVQPTKFNSFEASKKAGRCYHMSSFVETKALEHLTKSPVEFVEYNKSQLSRIYPK
GTRVDSSNFMPQLFWNAGCQLVALNYQTIDLSMQLNLFMFEYNGRCGYRLKPEFMRRPDK
HFDPFTENTVDGIVANTLSVKVISGQFVTERRVGVYVEVDMFGLPADTRRKALKTKTSQN
NNAVNPVWDEEPIVFKKVILPTLASLRIAAFEEGGKFIGHRIIPVSAIRPGYRYISLRNE
KNQPLILPAVFVHIEVKDYVPDTFADVIEALSNPIRYVNLLEQRSKQLAALTLEDVEEDQ
QTEDEADSCAERKSDVRPALLENGLMATTPKAAAANQQAAATEASKPAAKTEDLVLSVLI
DVPACTIEGLQLSKVYQKEQRRQFKELKELVRRHQKKLSELLREFSNKHKKVARQCSKSR
YPLPGPPPCAPRFPAFFFSFVRCARVLTLHAFFRASCSQSDKDERLQQLRDEQQQQLLAL
RQEQYYSQKYLQREHIKMLTERLSSLAEESHSGQMKKLKDVCDKEKKELKRQMDRRRTEK
INQAKTKEKHLAEEEKMEINKSYVNEVVQNIKRLEETQTKRHDQLVEQHTELLQEIQDQK
PKLQGAVEAEFQEKFQCLPGEIEDFLQD
Download sequence
Identical sequences G3PDG8
69293.ENSGACP00000015642 ENSGACP00000015642 ENSGACP00000015642

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]