SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000015670 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000015670
Domain Number 1 Region: 51-128
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000000036
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0055
Further Details:      
 
Domain Number 2 Region: 293-342
Classification Level Classification E-value
Superfamily RING/U-box 0.000000432
Family RING finger domain, C3HC4 0.014
Further Details:      
 
Domain Number 3 Region: 230-266
Classification Level Classification E-value
Superfamily SAP domain 0.0000229
Family SAP domain 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000015670   Gene: ENSGACG00000011849   Transcript: ENSGACT00000015701
Sequence length 348
Comment pep:known_by_projection group:BROADS1:groupXIII:13261030:13265325:1 gene:ENSGACG00000011849 transcript:ENSGACT00000015701 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QAGASSMWASCCGLLNEVMGTGAVRGQQPGFGAGAGPFRFAPSAGYSTYPPSGSGTPGLV
CKSCGQAFSVFRRKYICRDCKKSFCSLCSVLQENLRICATCHLLNATAFQRPLLMRLRVR
DLRQYLLLRNIPTDTCREKEDLVDLVLCHQGIEEEEGLSTAQSASELSAFVASREEQLSR
SDSSDTNQDIGDATSVSLLNMDASEHTLEVSPQTRCRARASLSDISSLRDIEGLSVRQLK
EILARNFVNYSGCCEKWELVERVNRLYRETEENRKSLENVSTTVTADGEKGPLTIQDDNL
CRICMDATIDCVLLECGHMVTCTKCGKRMSECPICRQYVVRAVHVFKS
Download sequence
Identical sequences G3PDJ6
ENSGACP00000015670

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]