SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000015690 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000015690
Domain Number 1 Region: 505-733
Classification Level Classification E-value
Superfamily RNI-like 9.61e-28
Family 28-residue LRR 0.042
Further Details:      
 
Domain Number 2 Region: 94-168
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000115
Family PHD domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000015690   Gene: ENSGACG00000011854   Transcript: ENSGACT00000015721
Sequence length 760
Comment pep:known_by_projection group:BROADS1:groupXIII:13268156:13275967:-1 gene:ENSGACG00000011854 transcript:ENSGACT00000015721 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALSLSGDDEEYDSESEQQRAANRPKPKVGTSSAVKLPSNRTSSGARRRRTRCRKCEACL
RTECGECHFCKDMKKFGGPGRMKQSCIMRQCIAPVLPHTAVCVVCKEAGKEDTLEEEEDK
FNFMLMECSICNEIVHPNCLKVSDASGVVNDELPNCWECPKCNHAGKSGKVLKQKRGPGF
KYASNLPGSLLREQKPVKEEVGDVSSATKRRPDREETPRFRPEEPLHRLPPLLSPSNLPR
PRPEDKLRKKRKLFDDDEEEDLGVRKKVHFVAPNRSDSHTSVFFFSSKEKSDDPYFSKLL
HRIKTEEEDDDAYYEEEDEESDQSLCSSPQAGPSSEGGSETQEKGPCPKARRKRRLPNRE
LSRELSKALNQEIQKTEDCLANENRQPLKVEPETENEEPKRLFRNGSELGDQRPHLKAKE
MNGTPWELRHFYPSQITPLGFNRSTPTNRPVPPHSPPKCVQMERHVIRPPPISPPPDRLP
LRDGKTHVIQREVWMKIFGYLAHQELCVCMRVCKTWNRWCCDKRLWTKIDLNRCTSITPL
MLSGIIRRQPLSLDLSWTNISKKQLSWLINRLPGLRVLRLSGCSWAAVSALCTSSCPLLR
TLDVQWVEGLKDPQMRDLLSPPTDNRPGQLDNRCKLRNVEDLRLAGLDITDASLRLISRQ
MPSLSMLDLSYCNHINDQSVNLLTAAGTTTRDSLTDINLSVCNRVTDHSLNFFKRCGSIC
QIDLRFCKQVTKTACERFIAEMSVSVPFRLKEDKLLQKTS
Download sequence
Identical sequences G3PDL6
ENSGACP00000015690 69293.ENSGACP00000015690 ENSGACP00000015690

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]