SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000015733 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000015733
Domain Number 1 Region: 253-400
Classification Level Classification E-value
Superfamily PH domain-like 1.75e-30
Family Third domain of FERM 0.0017
Further Details:      
 
Domain Number 2 Region: 57-143
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.24e-20
Family First domain of FERM 0.0016
Further Details:      
 
Domain Number 3 Region: 144-252
Classification Level Classification E-value
Superfamily Second domain of FERM 2.62e-20
Family Second domain of FERM 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000015733   Gene: ENSGACG00000011892   Transcript: ENSGACT00000015764
Sequence length 1004
Comment pep:known_by_projection group:BROADS1:groupXVII:14100397:14121542:1 gene:ENSGACG00000011892 transcript:ENSGACT00000015764 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVRIIRGMEDVVASSSQLVWSVAHQTLRRWYSRGLMPCRRLLEAWFGIGKCYQMTEGRL
CQVHLLDGRKLELLVQPRLLSRELLDLVASHFNLKEKEYFGLSFIDDTGQSNWLQLDRKV
LDHDFSKTSGPAELRFLVRFYIEKITFLKENTTVELFFLNAKSLVFNETIEVESEHVFKL
AAFALQEAKGEYTSADTARSDLKQLPVLPTRVLREHPSLNFCEDKVIEHYTKLKGLTRGQ
AIVQYLALVESLPTYGVHYYPVKDKQGLPWWLGVSYKGIGQYDLQDKLKPRKLYHWKQLE
NLYFREKKFAVEVNDPHRRTVTRRTFGQTGLVIHTWYASHSLIKTIWVMAISQHQFYLDR
KTSKSNVSTTRSSGDIAMDLTEISAPRIIKRSTIESRDRLIMASNGSLISAGSADSEVSD
EQKKEKVAELKKKEKHLQDQLAQKIEELKKICMKEAELTGRLPGDYPLATGEKAPHVRRR
VGTAFKLDDLFPYDDDPHLRNLESRFALQQKIVEAAMKLSNEGDLCKTVKKKRRNNCLDA
ARKLEEIENEINDYRIKKGKKPTQRASLILADDVKLSDLSSLSDSLTLDDDDEPISQRQW
STSVPYSPHPHHADALDVHYNNERGSASDQHADSSHCDALSSHSSPLKAASRQPRDARSM
PPTPLLTRNAYSSSQLRGLEDEPQLFRQRSGSLESQSQLATETGPPVPTFTMAPARRSNS
TEVLDDGSSYTSHSSAEYSVPGNPAHRRRARGRHRNVYANTGSMPNLAQPDTRCHASQPR
GRPTTTAYCVTGYRTYQEPEPYPDRDYMYNNEMQGHYSLNPSYRHVPAAYHGHYAPDELD
GMSQNPYATLRPPRSRPAPRANEHAVQKEMVAEHLRGWYHRNAAQRQPAYNYDYDRGSQQ
SLGYQTTAAPHSSRNISYSVSSVSSSVNWQGTMSVCSGMSEYNMPVHAPQSYAYSTTPYT
HSAHHRSYRDVGQMDSLIGHQMHTDLQLEDQICWNEDSKPGTIV
Download sequence
Identical sequences G3PDQ9
69293.ENSGACP00000015733 ENSGACP00000015733 ENSGACP00000015733

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]