SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000015740 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000015740
Domain Number 1 Region: 526-797
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.37e-78
Family Protein kinases, catalytic subunit 0.0000127
Further Details:      
 
Domain Number 2 Region: 369-482
Classification Level Classification E-value
Superfamily PH domain-like 7.19e-27
Family Pleckstrin-homology domain (PH domain) 0.000038
Further Details:      
 
Domain Number 3 Region: 93-168
Classification Level Classification E-value
Superfamily Cysteine-rich domain 2.09e-20
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.00086
Further Details:      
 
Domain Number 4 Region: 222-286
Classification Level Classification E-value
Superfamily Cysteine-rich domain 9.27e-18
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000015740   Gene: ENSGACG00000011900   Transcript: ENSGACT00000015771
Sequence length 840
Comment pep:known_by_projection group:BROADS1:groupXVIII:12613115:12627157:-1 gene:ENSGACG00000011900 transcript:ENSGACT00000015771 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SRLSDSSPTAPSPTGSRGSVHGVSFLVQIGLTRETVTLEAGEHSLAAVRELVCSIVDHKF
PECGFFGMYDKILLFRHNLNSDNILQRLSSAEEIHEGDLVEVVLSALATAEDFQIRPHTL
YVHSYKAPAFCDDCGEMLWGLVRQGLKCEGCGLNYHKRCAFKIPNNCSGVRKRRLSNVSL
PGAIARPPSTEFTPVPQDEVGVSKRPLLGAAKRNSLLSGRPIWMEKMVLGRVKVPHTFSV
HTYTRPTICQFCKRLLKGLFRQGMQCKDCKFNCHKRCAAKIPRDCLGEVDFNGAPEPACP
GPDSESTMEVDGCDAGSLDEQDDKLFFTEGPERDDETLRAISPCTSSNIPLMRVVQSIKH
TKRKSCTLVKEGWMVHYTSRDNMRKRHYWRLDSKSLTLFQNESGAKFYKEIPLCEILRVE
APLDPGGLPGGAKPPCFQVITAHVVYYVGEDGPTQHNPVLAPSGAGREVGRSWEKAVRQA
MMPVTPKVSMVTHEGSKKIQQDVSVSISVSNSQIQENVDISSVYQIFADEVLGSGQFGIV
YGGKHRKSGRDVAIKIIDKMRFPTKQESQLRNEVAILQNLHHPGIVNLDCMFETPEQVFV
VMEKLHGDMLEMILSSEKSRLPERLTKFLVTQILVALRHLHFKNIVHCDLKPENVLLASA
EPFPQVKLCDFGFARIIGEKSFRRSVVGTPAYLAPEVLRSKGYNRSLDMWSVGVIVYVSL
SGTFPFNEDEDINDQIQNAAFMYPSNPWREVSEHATDLINNLLQVKMRKRYSVDKSLSHP
WLQDYQTWLDLREFETRRGERYITHESDDARWEEHADERGLSCPKHFIMSPNLDDMDEDP
Download sequence
Identical sequences G3PDR6
ENSGACP00000015740 ENSGACP00000015740 69293.ENSGACP00000015740

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]