SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000015748 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000015748
Domain Number 1 Region: 673-783
Classification Level Classification E-value
Superfamily Ubiquitin-like 9.67e-29
Family Ubiquitin-related 0.00000305
Further Details:      
 
Domain Number 2 Region: 19-99
Classification Level Classification E-value
Superfamily Surp module (SWAP domain) 1.07e-28
Family Surp module (SWAP domain) 0.0000388
Further Details:      
 
Domain Number 3 Region: 128-209
Classification Level Classification E-value
Superfamily Surp module (SWAP domain) 6e-26
Family Surp module (SWAP domain) 0.0000056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000015748   Gene: ENSGACG00000011893   Transcript: ENSGACT00000015779
Sequence length 785
Comment pep:known_by_projection group:BROADS1:groupXIII:13339590:13344189:-1 gene:ENSGACG00000011893 transcript:ENSGACT00000015779 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPGPVQIVQPEPNNKVTNVNHNEAPAEETPATKPIVGIIYPPPEVRNIVDKTASFVARN
GPEFEARIRQNEINNPKFNFLNPNDPYHAYYRHKVNEFKEGKGQEPSAAVPKVMQQAMLQ
SQLSQKVQVIQEAVVPKEPPPEYEFIADPPSISAFDLDVVKLTAQFVARNGRQFLTQLMQ
KEQRNYQFDFLRPQHSLFNYFTKLVEQYTKILIPPKGLLIKLKKEAENPREVMDQVKYRV
EWAKFQERERKKEEEEREKERVAYAQIDWHDFVVVETVDFQPNEQGHFPPPTTPEELGAR
ILIQERYEKYGESEEVEMEVESEDDDDERAVRGEGHPSQPDQDTQVQDMDEGSDDDDDGM
KAPLPPDNPMPPPLPPTPDQVIIRKDYDPKASKAPPSIITPDEYLISPITGEKIQASKMQ
EHMRIGLLDPRWLEQRDRGIRERQTEDEVYAPGLDIESSLKQLAERRTDIFGSEETAIGK
KIGEEEIQKPEEKVTWDGHSGSMARTQQAAQANITLQEQIEAIHKAKGLVGEDDAREKIG
PSKPSEIHHQPPMQSQMNMPKPNPQMTMPRPMQSMPQVRTTLLSAVPVIPRPPMSPVVRL
TPGHVIASMPPMIPAPRINVVPMPPPAPHMMAPRPPPMVVPTAFVPAPPVPQPPSSAPAP
PSHPPPPHDDEPVNKKMKTEDNLIPEEEFLRRNKGPVAVKVQVPNMQDKTEWKLNGQVLN
FTVPLTDQVSVIKVKIHEATGMPAGKQKLQFEGIFIKDSNSLAYYNMSNGAVIHLALKER
GGRKK
Download sequence
Identical sequences G3PDS4
ENSGACP00000015748 69293.ENSGACP00000015748 ENSGACP00000015748

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]