SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000015750 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000015750
Domain Number 1 Region: 403-515
Classification Level Classification E-value
Superfamily PH domain-like 1.04e-25
Family Pleckstrin-homology domain (PH domain) 0.0024
Further Details:      
 
Domain Number 2 Region: 1-73
Classification Level Classification E-value
Superfamily SAM/Pointed domain 5.71e-18
Family SAM (sterile alpha motif) domain 0.0039
Further Details:      
 
Domain Number 3 Region: 201-291
Classification Level Classification E-value
Superfamily PDZ domain-like 2.5e-17
Family PDZ domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000015750   Gene: ENSGACG00000011904   Transcript: ENSGACT00000015781
Sequence length 683
Comment pep:known_by_projection group:BROADS1:groupXVIII:12629472:12653396:-1 gene:ENSGACG00000011904 transcript:ENSGACT00000015781 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPVSKWSPQQVVDWMRGLDDSLQQYIPSFQRQQVDGEKLLRMSHQELLSLGLSRVGHQE
LVLEAVDLLCALGVEKDNLKTLVGRMRAAHHSLSGSVSQRRKNPAYHNKISHQPSNEFLT
AVVELIGAAKSLLAWLDGAPTSANDFTSTKSRIIQLCLELTSTVQKDCTVYEIEEKILEV
SRALTGVCEKTVQVTSDPSKSELSCLEEVHITNIKPGEGLGIYIKSTYDGLHVITGTTEN
SPADQTQRIHAGDEVVQVNQQTVVGWQLRSLVEKLRAESGGVYLVVKKRPAGTSGCFAPA
PLKNLRWRPPLIQSLPLNMTSVASRKEKPTEDEIVFNLLPGKPRPVSMPVESFSVDPSSR
PGARGRKGQLPSETRLRRTLQKQLAASSVCGVTHQQPLLTVGSAMSRRGVSVRDLGPLDC
QGWLLRRKQGRRFLGSRWVRYWFVLKESSLYWYTSMTAPKAEGFILLSGFTVEQAKPCRK
KHVITASHPLIVTIFIAAETFIDMNKWLSKLSEAAGPRGEINAEGCYSEGSDQDADEPSV
TSSPPTSECQEGDSEDVSERRVKRDSPRSVFLSSLEKPPDEMENLYNHLRAASLSPIGQS
SGRDFRASFVRRCQDDRVNEQLHLLRILSSTLKAKELELLEVEQVERILAKPTLAAPEYR
KWRRSNGALLQEIAQRVAAAEQT
Download sequence
Identical sequences G3PDS6
ENSGACP00000015750 69293.ENSGACP00000015750 ENSGACP00000015750

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]