SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000015788 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000015788
Domain Number 1 Region: 267-618
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.47e-86
Family p120GAP domain-like 0.0000434
Further Details:      
 
Domain Number 2 Region: 574-716
Classification Level Classification E-value
Superfamily PH domain-like 2.95e-37
Family Pleckstrin-homology domain (PH domain) 0.0083
Further Details:      
 
Domain Number 3 Region: 112-239
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.68e-29
Family Synaptotagmin-like (S variant) 0.0064
Further Details:      
 
Domain Number 4 Region: 6-127
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.79e-28
Family PLC-like (P variant) 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000015788   Gene: ENSGACG00000011932   Transcript: ENSGACT00000015819
Sequence length 814
Comment pep:known_by_projection group:BROADS1:groupXIII:13358075:13370339:1 gene:ENSGACG00000011932 transcript:ENSGACT00000015819 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKNTSLYFRIVEGRNLPAKDVSGTSDPYCIVKVDNEVVARTATVWKNLSPFWGEEYTLH
LPMGFHSLSFHVMDEDTIGHDDVIGKITLSKEAIGSQAKGLDSWLNLTRVDPDEEVQGEI
HLSLQLLKDTEKISLRCQVIEARDLAPRDISGTSDPFTRVIFNNHSAETSIIKKTRFPHW
VETLELELDPEELREEGTVTVEVWDWDMVGKNDFLGKVEIPFACLHKTPPLEGWFRLLPL
GNDEVDAGGKLGALRLKVRLVEDRILPSVYYQPLIHLLVESVISPTEVEDSSALTMLEEV
NTVESRQDVAMTLVKIYLGQGLVVPFLDYLNTREVNHTADPNTLFRSNSLASKAMEQFMK
AVGMLYLHEVLKPIINRIFDEKKYIELDPCKIDLNRTSLGRRISFKSAVSEAEVRDSSVE
MLQSYLTTIIESIVGSVDQCPPVMRVAFKQLHKRVEEQFAEPEHEDVKYLAISGFFFLRF
FAPAILTPKLFQLRDQHADTRTSRTLLLLAKALQSVGNLGLQLGHGKEQWMAPLHPIILR
SVASVKDFLDKLIDIDHDIVSEVPQRAVFMPSVTVKEGYLNKHKAEGPQLLSRFAFKKRY
FWLTSETLSYAKTPDWQVRSSIPILCVCAVERVDENAFQQQNVMQVITQDNDGQLHTMYI
QCKNVNELNQWLSAIRKVSIYNERMLPSFHPGAHRSGKWTCCLQVDRAVTGCSRTHSAVT
LGDWSDPLDPDVETQTIYKQLLQGRDKLRSVEETVCNRHRTSCLTDGAECYDALMKPGQS
VAARLLAVIEDLEQAHATFQRREKEDGTSHSTMT
Download sequence
Identical sequences G3PDW4
69293.ENSGACP00000015788 ENSGACP00000015788 ENSGACP00000015788

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]