SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000015814 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000015814
Domain Number 1 Region: 1150-1255
Classification Level Classification E-value
Superfamily PDZ domain-like 2.23e-26
Family PDZ domain 0.0000269
Further Details:      
 
Domain Number 2 Region: 415-519
Classification Level Classification E-value
Superfamily PDZ domain-like 2.1e-25
Family PDZ domain 0.00000956
Further Details:      
 
Domain Number 3 Region: 921-1031
Classification Level Classification E-value
Superfamily PDZ domain-like 5.52e-24
Family PDZ domain 0.0000189
Further Details:      
 
Domain Number 4 Region: 791-887
Classification Level Classification E-value
Superfamily PDZ domain-like 1.18e-21
Family PDZ domain 0.0002
Further Details:      
 
Domain Number 5 Region: 617-705
Classification Level Classification E-value
Superfamily PDZ domain-like 1.18e-18
Family PDZ domain 0.00022
Further Details:      
 
Domain Number 6 Region: 125-248
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.83e-16
Family Nucleotide and nucleoside kinases 0.0063
Further Details:      
 
Domain Number 7 Region: 9-106
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000000000447
Family PDZ domain 0.029
Further Details:      
 
Domain Number 8 Region: 300-339
Classification Level Classification E-value
Superfamily WW domain 0.000000000000401
Family WW domain 0.0011
Further Details:      
 
Domain Number 9 Region: 344-385
Classification Level Classification E-value
Superfamily WW domain 0.0000000064
Family WW domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000015814   Gene: ENSGACG00000011944   Transcript: ENSGACT00000015845
Sequence length 1460
Comment pep:known_by_projection group:BROADS1:groupXIX:15214002:15269571:1 gene:ENSGACG00000011944 transcript:ENSGACT00000015845 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKSLKKKNHWTNKVHEAAITRGKDGELGFELRGGAEIGQFPYFGEVRQGKGLLQSGKLA
QDELLLEVNNMPVAGLTTRDVLAVIKHCKDPVRLKCVKQGGVVDKDLRHYLDLRFSKGSV
DHDHQQIIRDNLYLRTVPCTTRQPKEGEVPGVDYNFVSVERFMELEQSGALLESGTYEDN
FYGTPKPPAEPSPAAPPLNVSEALLPGARPSAQGKRKRNQSVSNMEQRASLEPPEEEEEE
SPVLNGNGVAITPESSEHEDKSTDASGEVAVETSSQAPTSVEPPAPKSPSKSPVKVPDMD
EEELGPLPDNWEMAYTEKGEVYFIDHNTKTTSWLDPRLAKKAKPPEECREDELPYGWEKI
DDPIYGSYYVDHINRRTQFENPVLEAKRRLEQQRQMQSQGLSALPLPTIYREKPLFTRDP
TQLKGNFLSTALQKSNMGFGFTIIGGDEPDEFLQVKSVIPDGPAAQDGKMDTGDVIVYIN
DICVLGTTHADVVKLFQSVPIGQSVTLVLCRGYPLPFDPEDPSGAASASLTPIGMEHRPL
VVNGRGSYDPYLEYLSLSSQLPPQALAQAGAPHPGDTHLDGSSLPPTTPGSVSGLTPHDD
NVSMASSGTAGGAGHAAQGAEFLTVTMVKGAEGFGFTIADSPTGQRVKQVLDPGSQGASG
LVEGDLILEVNQQPVAAAGHGRVVEMLKECPVGSEATLLIQRGATGHISPRKASKQLPDQ
WDPHGSPQANLSGPVLPPGTPFPNQPQHRTSVPDSTEGFDLNKPDPYDLYEKSRAIYESR
RKESPLVVAICASGPEYEEVEVHLLREKTGFGFRILGGDEAVQAIVIGAIIENTPAERDG
RLRPGDELISVDKNVVAGKPHKYVIDLMHAAARNGQVSLTVRRRVQMPGELCPVNGRSPG
SVSTQHSSPRSDAASASGPPAVVVPTATSPPERSALQTSDVVIHRKDNEGFGFVIISSLN
RPENASVITVPHKIGRIIEGSPADRCGKLKVGDRILAVNGQSIISMPHADIVKLIKDAGL
TVTLHIIPEKDLTGSHSGPSSEKQSPMTQKHSPQNQHIPVAQPGQPAGTQHSPVSQPSGP
PPQLYLHDGSHRSEVKARQDVKPDFRHPPFTDYRQPPVDYRHPPVSDYRQPPTLDYRHPP
GLLDFRQHPAAAQFPLGIPPDFRHQDYDYFTVELEKSTKGFGFSIRGGREYKMDLFVLRL
AEDGPAIRNGRMRVGDQIIEINGDSTRDMTHARAIELIKAGGRRVRLLLKRGTGQVPEYD
CAAPWDTFSTAHPALQEVTLEPYLNPSLSFHLALVTPHQLPLEATVYTADKASQPADHSS
VRGATGGRSTHQKCITRGQGTQQGSGELDCGPGERRPCVLPPKAALARSVERRERQRDTC
SPCCESSGDGHVSLQERPVSRGLFTREDERASGHGGLCCPSKTADDPPARSAAASPGPWN
VPGSDKLPGTLRSWTSTVSR
Download sequence
Identical sequences G3PDZ0
ENSGACP00000015814 69293.ENSGACP00000015814 ENSGACP00000015814

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]