SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000015826 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000015826
Domain Number 1 Region: 338-611
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 3.77e-40
Family C5 cytosine-specific DNA methylase, DCM 0.0053
Further Details:      
 
Domain Number 2 Region: 13-140
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 1.44e-26
Family PWWP domain 0.0000876
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000015826
Domain Number - Region: 235-306
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0106
Family PHD domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000015826   Gene: ENSGACG00000011949   Transcript: ENSGACT00000015857
Sequence length 616
Comment pep:known_by_projection group:BROADS1:groupXII:15690926:15695924:-1 gene:ENSGACG00000011949 transcript:ENSGACT00000015857 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DKDSKRGLESQDEDGKGFLTGELVWGKVKGFSWWPGMVMPWKAKSSPLGMRRVEWFGDGM
FSESYTESLLTFRNFNRCFCKNSFASLPIYKEAIYQIIELASERCEKSFVEAEGNKEKEL
KLMLDWASGGFLPSGPEGFSPTDAAAHQDFSDSATSDNQPPAKRKYVHKNKANAPVIICH
KESIREMVKEKGRKIEDFCLSCGSLEIEVQHPLFEGGLCLKCKGNFTETLYRYDEDGYQS
YCTVCCAGLEVILCGNASCCRCFCKDCLEILVGPGTFDELKDVDPWSCYMCKPAHCKGNL
KLRPDWSVRVQDFFANDTAMAFEPHRVYPSICADQRRPIKVLSLFDGIATGYLVLKDLGF
KIERYLASEICDDSITVGMIKHEGKIEYVNDVRTITRKHLAEWGPFDLLIGGSPCNDLSM
VNPLRKGLFEGTGRLFFEFYRLLTLLKPKEGDDRPFFWLFENVVFMSANDKSDICRFLEC
NPILIDAVKVSPAHRARYFWGNLPGMNRPLATSLDDKVGLQDCLEGGRKAMFDKVRTITT
KSNSIRQGKMGPLPVTMNGKEDYLWCTEMEQIFGFPKHYTDVNNMGRSQRQRVLGRSWSV
PVIRHLFAPLKDYFEC
Download sequence
Identical sequences G3PE02
ENSGACP00000015826

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]