SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000015830 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000015830
Domain Number 1 Region: 160-278
Classification Level Classification E-value
Superfamily PX domain 2.75e-25
Family PX domain 0.0013
Further Details:      
 
Domain Number 2 Region: 40-147
Classification Level Classification E-value
Superfamily PDZ domain-like 1.31e-24
Family PDZ domain 0.006
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000015830
Domain Number - Region: 288-349
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000207
Family Ras-binding domain, RBD 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000015830   Gene: ENSGACG00000011965   Transcript: ENSGACT00000015861
Sequence length 572
Comment pep:known_by_projection group:BROADS1:groupXX:12995964:13002352:-1 gene:ENSGACG00000011965 transcript:ENSGACT00000015861 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADVEGQGICSTVPELPHPSSRNGSGSGNVTPGGTGGSCQTATTVTSGPRLVRVVKSDSG
YGFNVRGQVSEGGQLRSINGELYPPLQHVSAVLPGGAADRAGISKGDRILEVNGVNVEGA
THKQVVDLIRAGERELALAVLSVPPQETDCLDPGDDISTQSCYDYSDKQAVPISVPSYKH
TELNQEKFVVYNVYMAGRQLCSKRYREFVILHQNLKREFAIFTFPKLPGKWPFSLSEQQL
DARRRGLEEYLEKVCSVRIIGESDIMQEFLSESDENYNGVSDVELRIAMPDKSPLTVRVC
KNSTTDQVYQAVVMKLGMDSVTASYFALFEVINHTFVRKLAPNEFPHKLYVQNYTSAIAG
TCLTLRKWLFTTEEEILLNDNQLAVNYFFHQAVDDVKKGFIKAEQKSYQLQKLAEQKKLS
MYMSLLRDCEGYNEIIFPHCSCDSRRKGHVITAISIRHFKLHACTEEGTLENQVIAFDWG
EMQRWDTDEEGMAFCFEYARGEKKPRWVKIFTPYFNYMHECFERVFCELKWRKEVEEEAT
DKDNKNCSKDEYFPAAEAQKGWRHLGREIVTS
Download sequence
Identical sequences G3PE06
ENSGACP00000015830 ENSGACP00000015830 69293.ENSGACP00000015830

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]