SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000015844 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000015844
Domain Number 1 Region: 1-90
Classification Level Classification E-value
Superfamily EF-hand 9.69e-24
Family S100 proteins 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000015844   Gene: ENSGACG00000011970   Transcript: ENSGACT00000015875
Sequence length 99
Comment pep:known group:BROADS1:groupXX:13023636:13025146:-1 gene:ENSGACG00000011970 transcript:ENSGACT00000015875 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTELEKCMESLITIFHRYADADGDGKSLSKKELNKLVETELPTFLKSQKNPKVVEQIRKD
LDQNGDDKVDFEEFLSLIVGLSIACEKCFMLHEQKKGKK
Download sequence
Identical sequences G3PE20
ENSGACP00000015844

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]