SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000015871 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000015871
Domain Number 1 Region: 509-538,567-716
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.46e-37
Family SPRY domain 0.0088
Further Details:      
 
Domain Number 2 Region: 444-546
Classification Level Classification E-value
Superfamily Fibronectin type III 1.57e-16
Family Fibronectin type III 0.0023
Further Details:      
 
Domain Number 3 Region: 226-289
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000305
Family B-box zinc-binding domain 0.002
Further Details:      
 
Domain Number 4 Region: 2-41,130-165
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000795
Family RING finger domain, C3HC4 0.024
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000015871
Domain Number - Region: 169-203
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.068
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000015871   Gene: ENSGACG00000011995   Transcript: ENSGACT00000015902
Sequence length 725
Comment pep:known_by_projection group:BROADS1:groupXV:11740267:11769069:-1 gene:ENSGACG00000011995 transcript:ENSGACT00000015902 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDEMEEELKCPVCGSFFREPIILPCSHNICLACARNILVQTPDAESPRSSRASGSGVSDY
DYLDLDKMSLYSEADSGYGSYGGFVSAPTTPCQKSPNGVRVFPPAAPQPAPQQHLLPQPG
SLPPIPRNSCITCPQCHRSLILDERGLRGFAKNRVLEGVVDRYQQSKAAALKCQLCEKSP
KEATVMCEQCDVFYCDPCRLRCHPPRGPLAKHRLVPPAQGRISRRASPRKTSTCTEHELE
NLSMYCVQCKMPVCYQCLEEGKHGTHEVKALGAMWKLHKGQLSQALNGLSDRATEAKEFL
IQLRNMVQHIQENGVEFEACLVAQCDALIDALNRRKAQLLARVNKEHEHKLKVVRDQISH
CTVKLRQTTGLMEYCLEVIKENDPSGFLQISDALIRRVHVTEGQWGKGTLTPRMNSDFDL
TLDSGPLLQTIHQLDFVQMKEQSPLPAAPMLQLEECCTQNNSATLSWKQPPLTTIAVEGY
ILELDDGNMGPFREVYVGTETICTVDGLHFNSTYKSRVKAFNGSGVGQYSKTLIMQTSES
TSSISSSPPAANYSGSTSLLSTLKALCFAWFTFDPASAHQDIILSNDNLTVSCNSYDDRV
VMGNSAFSRGVHYWEMTVDRYDNHPDPAFGIARGDVLKDVMLGKDDKAWAMTDGGIGKGA
TIGILLDFTRGILIFLINDEQQGPVAFEALEGVYYPAISLNRNVQITLHTGLPIPDFYTA
GEADP
Download sequence
Identical sequences G3PE47
69293.ENSGACP00000015871 ENSGACP00000015871 ENSGACP00000015871

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]