SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000015873 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000015873
Domain Number 1 Region: 216-280
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000885
Family B-box zinc-binding domain 0.0016
Further Details:      
 
Domain Number 2 Region: 591-622,671-762
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000000000611
Family SPRY domain 0.024
Further Details:      
 
Domain Number 3 Region: 424-539
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000465
Family Fibronectin type III 0.0034
Further Details:      
 
Domain Number 4 Region: 24-69
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000656
Family RING finger domain, C3HC4 0.016
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000015873
Domain Number - Region: 168-202
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.009
Family TFIIH p44 subunit cysteine-rich domain 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000015873   Gene: ENSGACG00000011991   Transcript: ENSGACT00000015904
Sequence length 785
Comment pep:known_by_projection group:BROADS1:groupXX:13031506:13038146:1 gene:ENSGACG00000011991 transcript:ENSGACT00000015904 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADSELETFTSIMDALVRISSNMKSMEQELRCPMCDEMVKQPILLPCQHSVCLLCAAEVL
VQRGYPPPDLPPEPNSPASTPNTRSPRQARRPTPRTPDRLERVLRTVCGTYPGRRRKEAA
PPPMLLPCPSCQRDVELGERGLTDCLRNLTLERIVERYRHTVSLGSVAIMCGFCKPPQTL
EASKGCADCKSNFCNECFKLYHPWGTPRAQHEHILPTNNFRPKVLTCTEHEQERLQWYCR
DCHRLLCPLCKLRRIHHGHKVLPIAQAYQALKDKVTKEVNFVLANQETIQSQITQLEAAI
KQMEANSAVALHQLTHCIRELGAAVAERQGALAVALEGSRSRREEALSSQVWERRGLLEH
AGLMAYTQELLKETDPPCFVQAARVTHGRLVKAIANLQCFSLSADPSFRNFYLDASKEVE
LIHSLEFINAPVAPVIDTQKTLAYDQLFLCWRLPQDSAPAWHFSVEYQRRAGGAAATWGG
TRSPNAATAWLRLDEVRGTNAVINRLQMDSVYVLRVRGCNKAGFGEYSEEVYLHTPPAPV
LSFSLDSRWGLHADRLALGRGQTYARSVPGLSLLQAADRTLTSCHLTSDLLVADLAVTQG
RHYWACSVEPGSYLVKVGVGQEAKLQEWFHLPQDMASPRCDPDSGHDSGAEDGQDSPPFC
FLTIGMGKILLPQGHGHTQSQGDGQSLGAVHGHGASHNNLPHPHTAPLPPRLGVCLDCDK
GHVTFYDAHSLRVLWVGHMDCSSPVCPAFCFIGGGALQLQDLVATRSVEEPPPRRVTIQT
RATNL
Download sequence
Identical sequences G3PE49
ENSGACP00000015873 ENSGACP00000015873 69293.ENSGACP00000015873

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]